SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013731 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013731
Domain Number 1 Region: 522-610
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-17
Family Third domain of FERM 0.0077
Further Details:      
 
Domain Number 2 Region: 337-430
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000246
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 
Domain Number 3 Region: 233-278
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000144
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 486-521
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000262
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013731   Gene: ENSGACG00000010383   Transcript: ENSGACT00000013756
Sequence length 633
Comment pep:known_by_projection group:BROADS1:groupXV:8881765:8912733:1 gene:ENSGACG00000010383 transcript:ENSGACT00000013756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLP
NMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLEL
QGPLLTPGSGSIYSSPGLYSKTMTPTYDSRDGSPLSPTTAWFGDSPLSEGNPSILAVSQP
ISSPDILVKLYKPQSLLDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSFFDLNPKY
DAIRVNQLYEQSKWAILLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNNSEKEVDEV
DAALSDLEITLEGGKTSNSLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISC
YKSKEEAHGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDMEKQYAH
WMAACRLASKGKTMADSSYNLEVQNILSFLKMQHMNPDPQFIEPITTDINPECLVSPRYL
KKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKRDELIG
ITYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVKVEFADEPCLSFICAEVDCKVVH
EFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWI
Download sequence
Identical sequences G3P807
ENSGACP00000013731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]