SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013735 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013735
Domain Number 1 Region: 573-661
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Third domain of FERM 0.0077
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000029
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 
Domain Number 3 Region: 277-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000157
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013735
Domain Number - Region: 537-572
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000157
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013735   Gene: ENSGACG00000010383   Transcript: ENSGACT00000013760
Sequence length 684
Comment pep:known_by_projection group:BROADS1:groupXV:8883161:8912733:1 gene:ENSGACG00000010383 transcript:ENSGACT00000013760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKPDVKKDWSD
HALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELQGPLLTPGSGSIYSSP
GLYSKTMTPTYDSRDGSPLSPTTAWFGDSPLSEGNPSILAVSQPISSPDILVKLYKPQSL
LDKAKINQGWLDSSRSLMEQDVKENEVLLLRFKYHSFFDLNPKYDAIRVNQLYEQSKWAI
LLEEIECTEEEMMMFAALQYHINKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKT
SNSLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPAHQMN
LRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDMEKQYAHWMAACRLASKGKTMAD
SSYNLEVQNILSFLKMQHMNPDPQFIEPITTDINPECLVSPRYLKKYKNKQPGSIRDMIS
ARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKRDELIGITYNRLIRM
DASTGDAIKTWRFSNMKQWNVNWEIKMVKVEFADEPCLSFICAEVDCKVVHEFIGGYIFL
STRAKDQNESLDEEMFYKLTSGWI
Download sequence
Identical sequences G3P811
ENSGACP00000013735 ENSGACP00000013735 69293.ENSGACP00000013735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]