SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013803 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000013803
Domain Number - Region: 58-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000125
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013803   Gene: ENSGACG00000010428   Transcript: ENSGACT00000013828
Sequence length 348
Comment pep:known_by_projection group:BROADS1:groupXI:8213244:8217431:1 gene:ENSGACG00000010428 transcript:ENSGACT00000013828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGLNSTMDVLALEAKSVNGADAEKKSSSRPKPKPPKKAKRIVYFEVEIVDLKTKEKLLLL
DKVEPTATVLDIKALVHKSYPKWYPARQSLRLDPKAKCLRDEEILQTLPVGTTASFYFRD
LGPQLTWGTVFLTECVGPLIIYLMFYFHLPFIYSPKYDFTSSKHWVVHLACICHSFHYIK
RILETMFVHRISHGTMPLKNIFKNCGYYWCSAAWMAYYINHPLYTTPYYGQMQVNAGLYV
FLFCQIGNFSIHVALRNLKPPGSKTKKIPFPTKNPFTWMFWLVSCPNYTYEVGSWIGFTV
MTQCVPVAFFTLVAFIQMTVWAKGKHGSYLKEFRDYPTLRSSILPFIL
Download sequence
Identical sequences G3P879
69293.ENSGACP00000013803 ENSGACP00000013803 ENSGACP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]