SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013815 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013815
Domain Number 1 Region: 70-288
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-50
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 294-406
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000012
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 3 Region: 413-471
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000114
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013815   Gene: ENSGACG00000010446   Transcript: ENSGACT00000013840
Sequence length 494
Comment pep:known_by_projection group:BROADS1:groupXX:11922150:11928097:1 gene:ENSGACG00000010446 transcript:ENSGACT00000013840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRNSRFFNTAQLYQQYSEAAQNIEIKRQARSDVVSVNLPLPEPPKSESRPPSPRLSISLS
QSATLWRELPGVQDSTELEKLTDDQRRLQEVRFEVVTSEASYCRSLDIVVEHFVQSKPLG
ALLTTQERNWLFSRLADVRAISHSFLSKLEERVETDIMQFTVCDIIARHCQRFKMVYVPY
LTNQSYQDATYQRLMNENPGFRRNVERLERSPVCQRLPLRSFLVLPFQRITRIKLLVQNI
VKRTTPGTAAATQAIKSLKLLEKLIQQSNDSITEMKSIESLVSLNAKVDFEGRTLPLISQ
SRRLVREGPLTELMDNCQKETERSVYLHLFNDYLLLSLLKEGGRFTVIDHCPVSDVRAEN
FGFKLHSLQKNLFRLHMTHRSPVLRTDTQSDKLRWMSALSRKNPEIDFLGVKDLPQMQCI
RAIVSQQPDELSLEKADIIQVHQQSSDHWVQGIRLSDRQHGWVPESHLETIINPKVRQRN
LEDALKLTTATAAV
Download sequence
Identical sequences G3P891
ENSGACP00000013815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]