SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013826 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013826
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-36
Family GABARAP-like 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013826   Gene: ENSGACG00000010464   Transcript: ENSGACT00000013851
Sequence length 117
Comment pep:known_by_projection group:BROADS1:groupXX:11928573:11932004:1 gene:ENSGACG00000010464 transcript:ENSGACT00000013851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQYQRSVPLEVRRAEGERVRAKHPDKIPIIVERSTRSRAPELDKKKYLVPADLTVGQL
CFLIRQRVSLRPEEALFFFVNNSLPPSSSPLSAVYEEHHGEDLFLYLTYSNESVYGA
Download sequence
Identical sequences G3P8A2
ENSGACP00000013826 69293.ENSGACP00000013826 ENSGACP00000013826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]