SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013837 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013837
Domain Number 1 Region: 56-289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-54
Family DBL homology domain (DH-domain) 0.0000302
Further Details:      
 
Domain Number 2 Region: 289-418
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-35
Family Pleckstrin-homology domain (PH domain) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013837   Gene: ENSGACG00000010468   Transcript: ENSGACT00000013862
Sequence length 985
Comment pep:known_by_projection group:BROADS1:groupVIII:13135192:13149466:-1 gene:ENSGACG00000010468 transcript:ENSGACT00000013862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGEMDETDAVRPKRCNEDAISLAPSTTESIIVEDAHYAAVRADLESDAQDLEVESWSLA
VDQQYVKKHSKETVKRQDVIYELMQTEMHHVRTLKIMLRVYVQELKDKLQMDAGKLDCLF
PQLENLLELHTHFLSRLKERQRENFVSPNDRNYAINRLADILISQFSGEIGERMKESYGD
FCSHHTEAVSYYKEQLHNNKKFQNLIRKINNLSIVRRLGVSECILLVTQRITKYPVLVER
ILHNTEAGTDEHEDLTRALGLIKDTIVQVDTLVNLHEKNSRLRDINIKMEPKAQGKIKDG
RVFRREDLAQGRRRLLHEGTVNWKAASGRLKDILAVLLSDVLLLLQEKDQRYVFAAVDNK
PSVISLQKLIVREVAHEEKAMFLICASSNEPEMYEIHTAGKEERNTWMTHIRQAVESCPH
TEERLFSEEEEARASRFKEFQERLSQKDAVVVQALTEKLQLFADMAASVAGLEDTASRSR
LLLRGDASDLQQGEALLKGALTEVENLQNLLQSGVREDSPTSRLDEGSGSGLLPRRADTF
GGYDSSPAIISKNGSVKKKFSAETRSRDRSQRASSDPQLKDLCGSHALEQTLSSTVSSPF
RSKEHTKLPSLNGSQFFDRVLMLSQRLYSLQAIVSQQDSHIELQRASLTERAALPGRHRG
NVLLEQEKQRTLALQREELASFHKLQAQHRQEQHRWERERERHRQQVEATEARLRQREEE
CRRLEEHLAEERRELESQRETYQQDLERLRESTKAVEKEKERLEHQKIKRKTIEVGSMLQ
SCIMGRAPSSSVSLWAPGGEKPLVRASLSVAPADYLERPKVMLRREAGSSTLPAKAVPTH
LLSTTNQQHKLVGVQQQIPTKLAAGGGKGKGGKIGKASHRTDSTASVDMKQMLPLKLSAR
DDNTLKAKRSVSPQQQLSLSPPPQPLPLRPHSRPPPSLPTRRPAAASTCSRGASVRTPRP
ASSHSMPPAYKTAAEDLNKEDVIFF
Download sequence
Identical sequences G3P8B3
ENSGACP00000013837 ENSGACP00000013837 69293.ENSGACP00000013837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]