SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013888 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013888
Domain Number 1 Region: 1249-1428
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-49
Family DBL homology domain (DH-domain) 0.0000000491
Further Details:      
 
Domain Number 2 Region: 1885-2087
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-47
Family DBL homology domain (DH-domain) 0.0000195
Further Details:      
 
Domain Number 3 Region: 1438-1554
Classification Level Classification E-value
Superfamily PH domain-like 2.35e-32
Family Pleckstrin-homology domain (PH domain) 0.00000337
Further Details:      
 
Domain Number 4 Region: 2083-2201
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-31
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 5 Region: 268-407
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 6 Region: 1066-1202
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-16
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 7 Region: 499-632
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000471
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 8 Region: 1617-1682
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000922
Family SH3-domain 0.0038
Further Details:      
 
Domain Number 9 Region: 2251-2311
Classification Level Classification E-value
Superfamily SH3-domain 0.00000013
Family SH3-domain 0.00052
Further Details:      
 
Domain Number 10 Region: 168-247,274-302
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000475
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 11 Region: 18-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000562
Family CRAL/TRIO domain 0.018
Further Details:      
 
Domain Number 12 Region: 410-530
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000173
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 13 Region: 897-962
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000662
Family Spectrin repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013888
Domain Number - Region: 639-756
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00314
Family Spectrin repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013888   Gene: ENSGACG00000010486   Transcript: ENSGACT00000013913
Sequence length 2336
Comment pep:known_by_projection scaffold:BROADS1:scaffold_210:10750:33239:1 gene:ENSGACG00000010486 transcript:ENSGACT00000013913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYPRGCGKAECVRAVDVLTVLREKVAFVSGGRDKRGGPILTFPARTNHDRIKQEDLSQLV
TYLATIPCEDVCARGFTVVVDMRGSKWDSVKPVLRTLQESFSSNIHTALLIKPDTFWQKH
KTNLGSAKLSFETSLVSVEGLSRLVDPSQLTSDLGGSLEYDHVEWTELRLGLEEFTGAAT
QLLSQLEQLEAGLNRIPEPQDVDEARKLLEEHSRLRNTIATAPVDSLEREGRSLLQRMRL
GPSHGDASTEGGAGASNGSWLSGGADFHSVAPKVSSLLDRLQGARGHLLQSWSDRKLHLD
QVLQLHLFEQDATKMSDWIAHSQDLFLQTLSAVGQNHQHALDLQTQHQHFTANCMNGSMN
VDSVVTVATRLAEAGHHGAERIAGVSLRLQGDWRALTAALEERSNTLAMATSFHQGAEQF
LLRLEGWVQVCSEGALPSAATELEAATKKHQELNEEISANYTQVSESGKALMDVLQRCPA
TDSDNPTTRPDLANATHGIMGALHQVMQGHQEVEGVWQHRKLRLHQRLQLCVFQQDVRQV
LDWVEQHGEVFLNKHSGVGKSLHRARALQKRHDDFQQVAQNTYTNAEKLLEAADQLAQSG
ECKEEEIYQAARDLELRMQQAFIQRVEQRKLLLDLAVSFYTHTKELSVWMEGLQKQLSSD
LCVCPDTVEALQALISQQQQQQANTQEAAMSVIREGEDLILQLRYAQSVGAFNSLASVWR
WPQGSSLVHVETVLQQLEESHVQLEELFHQRKIRLDVYLQLRILQQCTLEVTGEMDAWKQ
DLHKQSQDFSAERLTLAQQRIHRHMERRLAMNNMIYEVIQQGHDLQQYITEVQASGKRPF
VTTSATHSACFLTGGGEAHKVNEGLLEVLRTPEWSKKGEVMLSSCMLDFQLSVWRPSSCK
RKHERLPAGPSRTHQVALALQQRAELLVRSGHYDPDAVRSCAQTVALHWQTLMLRIEDRL
KLVNASAAFYRTSQQVCGVLESLEQEYRREEDWCGGGERQPELLLPLVSKHMEQKEAFLK
ACTLARRNAEVFLKYIHRNSVTMANISGHSVPGVAEVTGHSRVPEQQVKGILSELLQREN
RVLHFWTLKKRRLDQCQQYLMFQNHGQQALDWLQQSGDRYLATHTSPGTTAAETQELLNQ
HREFCVSAKHTQEKVHLLIQLAESMLAKGHAHRTELRRCVSAVDKRYRDFTARMTQYRHL
LEGALGGCSQNNKDLELELTPNSLSDSDPEVNLSDPSHQVSDEKRRSARKKEYIMAELLQ
TERVYVRDLQECIETYLWEMTSGSEDVPPGLRTKDDIVFGNIQDIYEFHNSIFLKELENY
EQLPEDVGHCFVTWADKFHMYVTYCRNKPDSSLLIQQHGVGFFEEVQRRHGLTNSVSSAL
IKPVQRITKYQLLLKELLACCEEGKGEIKEGLDVMLSVPKRANDAMHVSMLEGLEEGLEV
QGELLLQDSFLVWEPKSLIRKGRDRHLFLFELSLIFSKEIKDSSGRAKYLYKSRLRTSEL
GVTEHIEGDPCKFALWVGRTPTSDNKTVLKAASLELKQEWVRSIRQVIQERRGHLRGALR
EPIPLPKTPNPTLARQRSISRRETSEDADSLGDASSQPDTVSIASRTSQNTADSDKLSGG
CELVVVLLDFASGGPGELGVRCGQTVELVERSAERPGWCLARTTDQTTQQEGLLPMSALC
LSHSHSAADMEGLIPLLTSRHSHEGGVSGATCPAAFGVGGAPAGGVGSPGPKRSGSGTGN
TLKRWLTSPVRRLSQGKADGQKKPPIRTRRRDNRLELTTPLSGNVPTKARKDEAGQSGGE
EEPEEENHTPLPPPMQIIKDPNNPEVNTNILLRFLIFYIMNIMVDLLNVLLLYKVFTLRK
RKATSVLWVSACPPQALDSDQGSNESDTETRDKALRGRMFVVNEMIQSEKDYVKDLAVIV
EGFMSRLEVRGIPEDMRGKDKMVFGNIQQIYDWHRDFFLVELERCAENHELLADLFIRHE
RRLHMYVVYCQNKPRSEVIVIEYDNFFEDIQHEISCRMSISDYLIKPIQRITKYQLLLKD
FLKYSSKGGLACDELESKAVKLMSLVPKRCNDMMNLGRLQDYEGKLTSQGKLLQQETFCV
GEQDGGVLSRSKERRVFLFEQIVIFSELLRKGSNNPGYQFKNSIKVSYLAMQDGVDGEPC
KFVLWSRDSAERFTLQAPSAGVKETWVETIGTLLDAQNNFLSALQSPIEYQRKEGGISVT
RPLSAGLPPLAPPTANGHAPQPPPDGEQEDQELVLVQQDFVAVREDEISVFCGEKVQILA
SNQQGQSLVYRPANSDSPAAEGWVARGALAPPTRATTTKNTPPPSSNQTSSSLPRP
Download sequence
Identical sequences G3P8G4
ENSGACP00000013888 ENSGACP00000013888 69293.ENSGACP00000013888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]