SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013892 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013892
Domain Number 1 Region: 592-726
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.42e-37
Family Synaptotagmin-like (S variant) 0.0015
Further Details:      
 
Domain Number 2 Region: 740-870
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.54e-28
Family Synaptotagmin-like (S variant) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013892
Domain Number - Region: 6-40
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0345
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013892   Gene: ENSGACG00000010497   Transcript: ENSGACT00000013917
Sequence length 905
Comment pep:known_by_projection group:BROADS1:groupI:10966797:10979564:1 gene:ENSGACG00000010497 transcript:ENSGACT00000013917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDLSYLTEEEQGVIMSVMRRDAELKKAEEERIRKLERTPESKTQVDSQLKYRTGEWFYE
AKSRRHMDKIHGSEIILASMKQRLERLKTPSSRGSDIAAPPKPARCSGALQPQEINVVEP
PENTDDVSTCRDQEPPETGVVDKKTKFTVTPSWTQSQKENNKPNNNDPTLNSDFSKSATG
PQVAERRGSVTEILSVNRISPHPRTPIQPSAQPDSISPSRKTSLQDDLSKTIPVLHLVTD
PDSKKLHSSKNRPSMKDTQDKRGIRLKKTDSTALTQTNKVNLIKKNKPLGDVKVAGGTNQ
SRLNKRFTKSDYDLTSIGNDSGSDDRNDRNFTVLPLNQTKLSPTLRTNRAQFNTLRDFWD
ESVSDTKESSKYSHPGIYYVSERPAPTKSPQTLQSQPKAPHERPPVPTAANDGKRNLSNY
ATAESKSSTKDANGEERPSKSQSRSGENDAEGQSLVRKALRRAEARPKNMAKSMEDITAS
LSPREHVLNIFFTGQEARQDPTADMRRISNVSSIPSPSPSLFSDPEHLKKISKSVPSFLQ
KEDVGRDPDFPCEDSDRTGRLMTDSSLNNLTGSSGMSSMSSLSGSVMTMYNGDFGTVEVQ
GNIHFSLNYVQRLREFHIFVTECQDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKK
KTRNPTFNEILRYRVRMEYLRTQTLILSVWHHDTFGRNSFLGEVDVDLSQWDFDHTQINC
LGLKGRTATTLAPSPGQGAMRVAIRFLPEIIRSEGLIKEGPNTGEVHIWVKECKNLPPIR
ATIDPYVKCFVLPDTSRKSRQKTRVLRRTVDPAFNHTMVYDGIRQADLSEACVELTVWDQ
DRLASSLLGGLRLGLGKGRSYGARVDWMDSTPYEAAMWERMMATPNEWVEDMLPLRVLSP
AKAGS
Download sequence
Identical sequences G3P8G8
69293.ENSGACP00000013892 ENSGACP00000013892 ENSGACP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]