SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013909 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013909
Domain Number 1 Region: 141-671,802-992
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.39e-233
Family Motor proteins 0.00000000559
Further Details:      
 
Domain Number 2 Region: 1677-1852
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000745
Further Details:      
 
Domain Number 3 Region: 1593-1651
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 4 Region: 18-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000245
Family Ras-binding domain, RBD 0.019
Further Details:      
 
Domain Number 5 Region: 995-1041
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000664
Family Motor proteins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013909   Gene: ENSGACG00000010494   Transcript: ENSGACT00000013934
Sequence length 2076
Comment pep:known_by_projection group:BROADS1:groupVIII:13255573:13285202:-1 gene:ENSGACG00000010494 transcript:ENSGACT00000013934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGSGGGSAGPNDHDGRSYLLQIYPRLAAQSTTCCSLQVQKDATAASVIADAAAALGLDPG
RMYVLAEVKECGGEEWVLEAGDLPAQRFLLWPRKAQEKHPQSLGFYFLLQERNHDGSIRY
VHLPPVTKAQEAQLADRGFLPPPQDDFADLCNLPVLNEDSILNNLRTRFYKKKIYTYAGS
ILIAINPFKFLPIYNPKYVKMYENHQLGKLEPHIFAIADVAYYAMLRKRVNQCIVISGES
GSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGNAKTAHNNNSSRFGKFIQ
VNYLESGVVRGAVVEKYLLEKSRLVSRENNERNYHVFYYLLLGASEEERKEFKLLPPEDY
FYLKQQNFKIEDEEDLRHDFERLQQAMEMVGFLPATKKQIFLVLSAILYLGNVTYRRKST
GRDEGLDVGPPEVLATLSDLLKVKEELLVEALTKRKTVTVNDKLILPYSHSEAITARDSM
AKSLYSALFDWIVLRINHSLLNKKDMEESVPCLSIGVLDIFGFEDFETPKVKMINLSNSD
LISIQNVLFCLNQEEYQAEGITWHNIDYTDNVGCIHLISKKPTGLLYLLDEESNFPHATD
ETLLAKFKQQHLGNNYFVSTPVMEPAFVIQHFAGKVKYQIKDFREKNTDHMRPDIVALLR
SSDRAYVRQLIGTDPVAMFRWGILRATIRGIAAFNEAGRSWAAKTSGAMSGVVRPISRTP
LGELQRSNAPIDRMYKVMHAEIISSIKNLPLDGEDPRKLLQSWGRLRFPRHILQKHKHTK
QRQVIPKSLLDSQSLKFIVSLTLHDRTTKSLLHVHKKKKKPPSISAQFQTSLTKLLETLN
RAEPFFIRCIRSNAEKKEMYLDEALVFQQLRYTGMLETVRIRRSGYGAKYTFQEFIEHFR
VLLPMNADASKEDIAALLEKKMGLDPTTYQIGKTKVFLKELERQQLQDMLHKDVKHKIIF
LQRWFRGRLQRKEFLVMRQAAILIQRSWRRYCIEERRRRAAAVIQAVWRGHRQRSEYHRQ
RQGATKIQALVRGHSARRSHQEGAGSTEKKAEENREVNTSSYTEVEQGKGEELEDEDEEF
DYETNGTLAEAGTQLDEQPFGRVTSNAPTPTCPDDASAASNEKRARAPAFSSGQSSRSQE
KRELRRRRGLEHNQRETERAASSSSSTPPSNKDQTSPLKSESQDSSRLKERADSKELDQY
TFVVRKVKEDKGGKKEAKQSPPSSSPVRPSSLPLHSADAVSAERNGLGEGVGAANLQRRH
GAFKEKPEKWKGRRSNGEYPDSTSSTQNKEERGKSLLFKLSNILKPFSRKRREDSLLHHN
AHVVREQKCISFSLIFCRSDTALIDSLSSGFEVAGAFSAKESPVVFEKSRAQGSSHGAAA
LSVGGIGVTLFLFRVFAMVKILKKRPHKEALTPDNAELTFAQTLAPTSAHLSRPLSQRHG
DTSKGLGRNPTIKISRATRVSEQWNASLDREITNANELRHLDEFLGNQVNDFRSRGKSLS
ATEAIFVTATMQFRETIKAMYSLPKPTIGYKGLMTGYQQKVMHLADDKQKAEVQLVVNLF
QSVLDGFIRGEMKKEEAEPAKPAKARKKRRKKDKSMESPLDHVFVNYQVNIVQSCDQCSY
YIWGMEKAYMCSDCKMVCHKKCLGKIITDCSTFCAKKGDEDSGGLHFGVRVGSLVNDKNP
VPMVLEMMLEHVEMQGLYTEGIYRKSGSANRMKELHQRLETDPHRVCLEDYPIHTVTGLV
KQWLRELPDPLMTFTHYSDFLHAVELPEKQEQLHAVYKELDELPMANFNTLERLVFHLVR
VCKEEGHNRMSPNSLAIVFAPCILRCPDNADPLLSMKDVAKTTTCVEMIINEQIRKYNEK
MVEIEQLEYAEALAVNQLKLKRQNTHYWHLPLRFSAPHKGAVVHEKGSSDLSVVPENEPL
DSDTEAENLMERIKSIKQEKEDLAYRLPEMEQPGSDQENFDSEASLSAESLLDEQQRASV
PCSETDGLLCELIPALSSTSSVSSCVSSPSDSPAASIRHLLQRRNPIIPATVKLPHGVPS
QSAAYKAAPEYRASKFFARRREHPGRRKDSTKSLYI
Download sequence
Identical sequences G3P8I5
ENSGACP00000013909 69293.ENSGACP00000013909 ENSGACP00000013909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]