SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013936 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013936
Domain Number 1 Region: 129-435
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-98
Family Protein kinases, catalytic subunit 0.000000000112
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-16
Family Pleckstrin-homology domain (PH domain) 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013936   Gene: ENSGACG00000010522   Transcript: ENSGACT00000013960
Sequence length 464
Comment pep:known_by_projection group:BROADS1:groupVI:13147228:13164638:1 gene:ENSGACG00000010522 transcript:ENSGACT00000013960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEYIKNWRPRYFLLKTDGSFIGYKEKPQDADLPYPLNNFSVAKCQLMKTERPKPNTFIIR
CLQWTTVIERTFHVDSPDERDEWTEAIQMVADKLQRQEEERFQCSPTSNIDNMVEEEMDI
STTHHKRKTMSDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLT
ESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEERTRFYGAEI
VSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVTYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKS
LLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVDWQYVYDKKMVPPFRPQVTSETDTRYF
DEEFTAQTITITPPEKFDEDGMDCLDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences G3P8L2
ENSGACP00000013936 69293.ENSGACP00000013936 ENSGACP00000013936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]