SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013947 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013947
Domain Number 1 Region: 896-1192
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000749
Further Details:      
 
Domain Number 2 Region: 215-357
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-29
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-28
Family Second domain of FERM 0.00051
Further Details:      
 
Domain Number 4 Region: 23-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-18
Family First domain of FERM 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013947   Gene: ENSGACG00000010542   Transcript: ENSGACT00000013972
Sequence length 1196
Comment pep:known_by_projection group:BROADS1:groupXV:9490435:9501192:-1 gene:ENSGACG00000010542 transcript:ENSGACT00000013972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVTRIQLLNGEFVEFTLSVESTGQECLEAVAQRLELRE
ITYFSLWYFNKQNLQRWIDLEKPLKKQLDKYGLEPTVYFGVVFYIPSVTQLQQEITRYQY
YLQLKKDVLEGRISCSLEQAIHLASLAVQADFGDFNRYDSQDFLQKFALFPIDWIQDERV
LEEATQKVALHYQSFRGLSAPEAEMMYMQEVEKMEGYGQESYQAKDSTGSDVSMGSCIDG
FFVKQKNGRPLSFRWNEINNMSHNRSFFVLELSNREESVQFQTEDMETSKYVCRMCLARL
KFYKINKSSLQAQPAVVNPVRRRSSTRISLPKPQSYMMPPPQMHYNGHFPEPYTSSQDNL
YLNSQNGYYYHSQTSLDCSPLEYGSGGRLRNGSVYSAHSTSSLTNPQHYHQPSPMSSNPS
ITSDITRPDYVPSHRHSALIPPSYRATPDYETVMRQKTRGGGVLLSQEHRQSHSMRNLNI
GNSYAYRRPDHLVYSQPEIRGEHGGAAQHHHYPFHLGSSFHGPSPYPYPTERRPVVGAVS
VPELTNVQLQQAQEYPAPNIMRTHVYRPPPPYPYAHPRPANSTPDLSRHPYVTSSNPDLI
ITRRVHHSVQTFQEDSLPVAHSLQEVSEPLFYGPPPRHPQHAQKRNSIEIAGLAHSLEGM
RVKERTASSSAADAATPPPAPLCGGRSHGSQLNVFIERTKTEERGGIREGAQYGHKKSLS
DATMLVHSSGEEEEFEEDAGRHIPLSHNAMACRPHHSLTSLSSPAPPQHAPTEPPPAYPI
GSSLEPAVTSPLNYKVHPLIQESEPLHLAPEYWQPRIMPSVSEGDLSGTAKQRAKKDVKK
RPVSDVPPGKKAVEGLPPPGMKKGARSEVKKMGPLKVAHLNGLSVSRQPMNEAAKDEDES
ASNDERCAALEQHMERGELLKEYESIPKRRPSGECTIAQLPESGDKNRFQDVLPYDDTRV
ELVPTKENNTGYINASHVKVTAGGREWSYIATQGPLANTCQDFWQMVWEQGVAIIAMVTA
EEESGREKSFRYWPRLGSRHNTVTYGRFKITTRFRTESGCYATTGLKIKHLLTGQERTVW
HLQYIDWPDHGCPEDLKGFLTYLEEIQSVRRHTNSISDPKNANLPVLVHCSAGVGRSGVV
ILSEIMIACLEHNEALDVPKFLLHLRRQRMMTVQTLSQYTFIYKVIIQYLRNSRLI
Download sequence
Identical sequences G3P8M3
ENSGACP00000013947 ENSGACP00000013947 69293.ENSGACP00000013947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]