SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013952 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013952
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-53
Family Necap1 N-terminal domain-like 0.000000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013952   Gene: ENSGACG00000010530   Transcript: ENSGACT00000013977
Sequence length 275
Comment pep:known_by_projection group:BROADS1:groupXX:12053276:12058279:1 gene:ENSGACG00000010530 transcript:ENSGACT00000013977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEGQSEYESVLCVKPEVSVYRIPPRASNRAIRAADWKLDAPDWTGRMRVTARGKAAFV
KLEDKISGELFAQAPVEEYPGITVETVSDSSRYFVLRIQDDNGRSAFIGIGFGDRGDAFD
FNVALQDHFKWVKQEDEFKKQAQTPDTTPKLDLGFKEGQTITLNIGQSKKRDRSRPQSSG
GFGLLPPPPGGKLAPPPSSRSTNHNTEPSAGGSDTGFLLDLDASNSNSADWEASNPATAA
SSDLWGDFDSVSSKSRPLSSSLNRLYPRTERWIKL
Download sequence
Identical sequences G3P8M8
ENSGACP00000013952 69293.ENSGACP00000013952 ENSGACP00000013952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]