SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013976 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013976
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.45e-47
Family VHS domain 0.0000507
Further Details:      
 
Domain Number 2 Region: 159-221
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013976
Domain Number - Region: 404-545
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00523
Family FCH domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013976   Gene: ENSGACG00000010562   Transcript: ENSGACT00000014001
Sequence length 758
Comment pep:known_by_projection group:BROADS1:groupXI:8332088:8339129:-1 gene:ENSGACG00000010562 transcript:ENSGACT00000014001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGGGTFERLLDKATSQLLLETDWESILQICDLIRQGDAQAKYAIGAIKKKLNDKNPHV
ALYALEVLESVVKNCGQTVHDEVASKQTMEELKDLLKQQTEPNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHEFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCFELLNKKAEGKAPTPGPAELPPEYL
TSPLSQQSQVEVKNEMPQMPPKRDEAALQEEEELQLAIALSQSEAEEKERMRHKNSYSMY
PKADPTPVTSSAPPVSTLYTPPVNSSAPSAEDVDPELARYLNRTYWEKKQEEARKSPTPS
APAPVPLAEPPPPISLPVESHVPVQPVSIVEQPYQNGESEENHEQFLKALQNSVTTFLNR
MKSNHMRGRSITNDSAVLSLFQSINNMHPQLLDILNQLDEKRLYYEGLQDKLAQVRDARA
ALNALRDEHREKLRRATEEAERQRHIQLAQKLEIMRQKKQEYLEMQRQLAIQRLQEQEKE
RQMRLEQQKHTIQMRAQMPAFSLPYAQMQSLPPNVAGGVVYQPGAPPSYPGTFSPAGSVE
GSPMHNMYMNQPGQTAPPQYQAMPAAAPDPNMVNAYMYQAAGTNGQPAPPPGQTPPTTSP
PYSNYQPTPTQGYQNVASQAQSMPPMPQPAPTNGMAYMGYQPYSMQNMISALPGQDPNIP
PQQQYIPGQPPMYQQVAPSGGVPQAVPGSVEAQLISFD
Download sequence
Identical sequences G3P8Q2
69293.ENSGACP00000013976 ENSGACP00000013976 ENSGACP00000013976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]