SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013988 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013988
Domain Number 1 Region: 302-405
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000392
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000013988
Domain Number - Region: 15-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.000139
Family HR1 repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013988   Gene: ENSGACG00000010576   Transcript: ENSGACT00000014013
Sequence length 546
Comment pep:known_by_projection group:BROADS1:groupXIII:11514738:11522213:-1 gene:ENSGACG00000010576 transcript:ENSGACT00000014013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKCVVIRTLRLISPLHHPLSLQDSDIQKKIDHEIRMRDGACKLLAACSQKDQTLEAAKSL
QTCSTRIMAYMSELQRMKEAQVMQKVTRRSSDAGPMEDRLPCKGKVAISDLRIPLMWKDT
EYFKNKGELHRCAVFCLLQLGGEIFDTDMVIVDRTLTDICFDNTIVFNEASPGFELRVEL
YSCCSEDDYSAGSTPRKLASKLSSSLGRSAGKKLRAAMEPGPCSPVSNGGAGPLLLPVPS
VPGPKYHLLAHTSLSLLHVQDSFRTHDLTISGNEECSYWLPLYGSMCCRLAAQPHCMTQQ
MMNGCLKVKQLGGDPQSWKKVYAVVKGTSLFCYHQQEDVEANVEPAFTIAVNKETRIRAS
EKDPHSKVQNICISNQYGGEEVTHSLTTDSREDTHRWMEAFWQHFYDMSQWKQCCDDVMK
IEMPSPRKPAPVTPKQGSLYHEMVIESSNDLSTTVSDILARREQSQKHCPPPSLYLSPLR
PQPLHPSSTAPEPSEPSPLPTVRPRTLSLDAKSSEGAPFSRPSPARRSLRNLKARLDPRN
WLQSQV
Download sequence
Identical sequences G3P8R4
69293.ENSGACP00000013988 ENSGACP00000013988 ENSGACP00000013988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]