SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014010 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014010
Domain Number 1 Region: 27-119
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-26
Family APG12-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014010   Gene: ENSGACG00000010597   Transcript: ENSGACT00000014035
Sequence length 119
Comment pep:known_by_projection group:BROADS1:groupXX:12092527:12095577:1 gene:ENSGACG00000010597 transcript:ENSGACT00000014035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMSDNVESPTETHKEEPHTPSDDSTTSDDKKKIDVLLKAVGDAPIMKTKKWAVERGRTV
QSLSQFISRFLKLDTSEQLFIYVNQSFAPSPDQDVGVLFDCFGSDGKLILHYCKSQAWG
Download sequence
Identical sequences G3P8T6
ENSGACP00000014010 ENSGACP00000014010 69293.ENSGACP00000014010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]