SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014033 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014033
Domain Number 1 Region: 309-428
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000981
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014033
Domain Number - Region: 48-101
Classification Level Classification E-value
Superfamily HR1 repeat 0.00392
Family HR1 repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014033   Gene: ENSGACG00000010606   Transcript: ENSGACT00000014058
Sequence length 660
Comment pep:known_by_projection group:BROADS1:groupVI:13320881:13325880:-1 gene:ENSGACG00000010606 transcript:ENSGACT00000014058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQRDVQTSKRNGSSGSLLSAGSAVAMEIKRKKIRESTLFLQTEKNTNIQEKLDFEMRM
REGAYKLLLACSKREQVLNASKNLLTCNARIKGYLTQLQKKKKQQEYFRSSDRDDRVPCK
GTIAMSGLRIPLMWRDSAYFNNRGSSRRVALFCLMQMGSEVFATEMSVVDRSVTDICFEG
VAVFKEALPQFELRVELWSCALEEELTLVNTPKKLAKKLRCSFGKTAGKKLCPPVDNPDP
DTFLQYNPIPMGAKYNLLAHTSLCLPEAEGSFQSHSLVVLQDAEWSSWLPLYGNLCCRLV
AQPACMTQTMTTGYLSQKLNVEGMYRCCSLYCALSSGLLSCYFTPEEIDAKVEPTLQVPV
NRDTRIRVMEKKSAGQKSRSLSIINPSPEGAETVVFTTESSQELEDWLDALRQHLYDQSQ
WLQCCNGLMKIEVASPRKPSLFLTKQADSVYNDLSINSPGKFESITDIIHSKIEETDGRF
LIGHEEEKEAPNWSSLFEGSHSVVVQKGFLPQSKTSTPCSSPNTSSTSISNKKRRAPPPP
SDREPHAPPSRPKEKENSGICTSRPATRSKTGRPSLDAKFSAIIQQLQRGNAGGAGALSR
KNAPLGVLDVQPQGQPPLQQPEFQNHSTEGEHAFVRPSHGPAPVPAARSKLRKSFRERMN
Download sequence
Identical sequences G3P8V9
69293.ENSGACP00000014033 ENSGACP00000014033 ENSGACP00000014033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]