SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014040 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014040
Domain Number 1 Region: 400-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-78
Family Protein kinases, catalytic subunit 0.0000000548
Further Details:      
 
Domain Number 2 Region: 846-985
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.31e-55
Family FAT domain of focal adhesion kinase 0.00000788
Further Details:      
 
Domain Number 3 Region: 133-254
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-40
Family Second domain of FERM 0.0000167
Further Details:      
 
Domain Number 4 Region: 31-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.4e-33
Family First domain of FERM 0.00036
Further Details:      
 
Domain Number 5 Region: 255-360
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-29
Family Third domain of FERM 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014040   Gene: ENSGACG00000010609   Transcript: ENSGACT00000014065
Sequence length 986
Comment pep:known_by_projection group:BROADS1:groupXVIII:10583092:10597725:1 gene:ENSGACG00000010609 transcript:ENSGACT00000014065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDTLSWKVPSPRKSSSGSSHESAFTGDGGPVKILKVCFCTNNNLGKNFKLVKCDSSWQ
IRAIIRSILICGRLGPNIGHAGCYGLLLKHLKSEELHWLHPDLTVGEVEQRYESHHVEAE
WRYDLRIRYVPVNFLKKFQDDRSTLVFFYQQVRSDYMQSYASKVSDGMALLLGCLEIRRF
YKDMNAKGLEKKSNFELLEKEVGLDLFFPQQLINSMKSKQLRKLIQQTFQQYATLKEEDC
MIRFFETLKEFINYDEEVFPCELVQGWSLAVELVIGGRGIRQRTQKNSAPVFLADFKQIK
KIQCLSQSDGKALLDLSVEGARQRLSINVATVPMAENMMDLIDGYCRLEKDTDESVIHRP
NADANARCALPEIPTESKRDSGSVRNRSDIYCEILDERPTSVVKYGIDRNDIVLGRILGS
GFFGEVYDGVYKKDSGERINVAVKTCKDCSPDVMEKFMSEAVIMKNLNHQHIVKLIGIIE
DDPVWIVMELYQYGELGNYLTENKNKLTNITLVLFSLQICKALVYLAGANVVHRDIAVRN
ILVASADCVKLGDFGLSRYIEHEEYYKASITRLPIKWMAPESINFRRFTTASDVWMFAVC
MWEIMSCGQQPFFWLENRDVINQLEQGIRLPKPDNCPPALYSLMTRCWSYDPSERPNFTE
LVVKISDVHNMEKEQEVERERDRARSTKIFDPKFNFNEPPPKPSRMKPGRFGNTLSIGLH
IQLKETLCASSPDLASPCDYQSPVDSMGALALPAIRSPRRRSFGEGEFSRVEVNVMEDAT
RLWQEERQQMQNTLRRQKEQMMEDKKWLAKEERLLDPMGAEEAAGTASPEGDAEHSPDKP
PRLTAQPTPTAELDRSEDKVYQNVMDLVKVVVQLKNDITEVPPEKYITVVQSVGMALRHL
IRSVDDILPTLHESVRTEIEGTQKLLNKDMAELISKMRLAQQNSITSLKEDCKKQMLTAA
HNLAMDSKNMLDAVDQARVRANLAKP
Download sequence
Identical sequences G3P8W6
ENSGACP00000014040 ENSGACP00000014040 69293.ENSGACP00000014040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]