SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014041 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014041
Domain Number 1 Region: 644-773
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-37
Family Regulator of G-protein signaling, RGS 0.000038
Further Details:      
 
Domain Number 2 Region: 16-95
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-19
Family PDZ domain 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014041
Domain Number - Region: 244-345
Classification Level Classification E-value
Superfamily PH domain-like 0.00451
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014041   Gene: ENSGACG00000010613   Transcript: ENSGACT00000014066
Sequence length 781
Comment pep:novel scaffold:BROADS1:scaffold_133:6287:18633:1 gene:ENSGACG00000010613 transcript:ENSGACT00000014066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTIHRLCRICIGQNLPQVNVVRGQDGFGFTIFSDSPVRVQGVELGGPAHRSGLRQGDSV
LQLNGLPVENWKCVDLANTIRSCSSQIVLVVWRSLPELRSGCDELLHPPTNNQERTSTVH
KHKQQAESCYLTPHTVNMAADWVKATQYFSRTTTLKGTRVTSSDGDNYIFLSPVIPGGQL
LQPVYHDSNGTIGNITPTIERSHSINEYTPPSNYNDYQNCNIIQSHLPCSGYGTYVTPES
KTLIFPVFVQPLNLCSPDRTLLMSEEMVLHQAHILPAKVTVLIYSDLLLFTREDKAGRGN
VLQSPLYLNTLQLREGMHTHTQHGIYLRARWHRLFILETFSVEQRLRVSLCLHDNVQSVA
QNHQVSLVTVRFRFSALSPHPPRRVTSSCFCCLVPVAPSRLAPHPKASSLSQRFPPVLVA
SSSTPCSCRLGTKSPSTSPQILASSPWVSLTFSLISSAPSPALSLSCSETLENVERVGER
GFLLSSHHLHMMEEEEEISDEEEELFTFTPRPADLRRSLSEGSLLQEPRTSRSMSDSITH
HLTSPLNFDAEPGTGSFPRHPSIHALKKQLTKEGGSLHHMLLLLNGDKKLDTETPKCRPE
TMVDKDVRSFQPRKNTCPLFLRQQKDTTFSHCNSLKKALRNNRPSTGEVIRWAASLEALL
TNKYGLAVFRYFLKLEFSEENLDFWLAVERFKRTRPLSKMVSRAANIYDEFVAVNASRQV
IVDSSVRESTNQGLRVGVDPMSFQLAQDQILSLMESDSYPRFLKSRLYTQLANGSLGLYR
L
Download sequence
Identical sequences G3P8W7
ENSGACP00000014041 ENSGACP00000014041 69293.ENSGACP00000014041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]