SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014105 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014105
Domain Number 1 Region: 496-660
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.36e-67
Family A middle domain of Talin 1 0.000000425
Further Details:      
 
Domain Number 2 Region: 759-895
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.69e-54
Family I/LWEQ domain 0.00000208
Further Details:      
 
Domain Number 3 Region: 2302-2491
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.83e-50
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 666-789
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.24e-48
Family I/LWEQ domain 0.00000555
Further Details:      
 
Domain Number 5 Region: 1845-1979
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.14e-47
Family VBS domain 0.00000778
Further Details:      
 
Domain Number 6 Region: 1232-1368
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.75e-42
Family VBS domain 0.023
Further Details:      
 
Domain Number 7 Region: 198-312
Classification Level Classification E-value
Superfamily Second domain of FERM 8.77e-30
Family Second domain of FERM 0.00000145
Further Details:      
 
Domain Number 8 Region: 1081-1214
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.04e-28
Family VBS domain 0.01
Further Details:      
 
Domain Number 9 Region: 313-403
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-23
Family Third domain of FERM 0.0000187
Further Details:      
 
Domain Number 10 Region: 1476-1561
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000034
Family I/LWEQ domain 0.0074
Further Details:      
 
Domain Number 11 Region: 1701-1820
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000033
Family VBS domain 0.054
Further Details:      
 
Domain Number 12 Region: 2010-2139
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000104
Family VBS domain 0.01
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000888
Family Ubiquitin-related 0.066
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014105
Domain Number - Region: 1591-1666
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000137
Family VBS domain 0.04
Further Details:      
 
Domain Number - Region: 928-989
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0194
Family I/LWEQ domain 0.0082
Further Details:      
 
Domain Number - Region: 2141-2297
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0746
Family I/LWEQ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014105   Gene: ENSGACG00000010642   Transcript: ENSGACT00000014130
Sequence length 2547
Comment pep:known_by_projection group:BROADS1:groupXIX:12148554:12186491:-1 gene:ENSGACG00000010642 transcript:ENSGACT00000014130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPSK
GIWLESGRTLDYYMLRNGDVLEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVTEEKKEDGMGTLRKDRTLLLRDERKMEKLKAKLHTDDELNWLDHS
RTFREQGLEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACE
FAGIQAQIQFGPHVELKHKPGFLDLKEFLPKEYTKHRGSEKKIFQDHKNCGEMTEIEAKV
KYVKLARSLLTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQDWPLTTV
KRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEE
STMLEESVSPKNSRSTILQQQFNRVGRVEHGSVALPGIIRSGSIGGPDTFNMGTMPSAQQ
QITTGQMHRGHMPPLSLAQQALMGTINSSMQAVQQAQADLGYVDNLPPLGRDLASRVWVQ
NKVDESKHEIHSQVDAITAGTASVVNLTAGEPTETDYTAVGCAITTISSNLTEMSKGVKL
LAALMGDEVGSGHKLMGAARMLAGAVSDLLTSVEPAAAEPRQTVLTAAGSIGQATGDLLR
HMGEGETDEKFQDTLMNLAKAVANAAAILVLNAKNVAQVAEDTILQNRVIAAATQCALST
SQLVACTKVVSPTISSPVCQEQLVEAGKLVDRSVETCVQACRSASGDGELLKQVGAAAGV
VSQALSDLLQHVRHYASCGEPIGRYDQATDTIMNVTENIFTSMGDAGEMVRQARVLAQAT
SDLVNAMRSDAEAEIDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREA
AEGLRVATNAAAQNAIKKKLVNRLEIAAKQAAAAATQTIAAAQNAAASNKNTISHQQLVH
SCKAVADSIPQLVQGMRSSQAQPEELGAQLTLIMASQTFLQPGSKMVISAKSTVPTVADQ
AAAMQLGQCAKNLGYLPCRGLCTHHLKAHEACGPLEIDSALKTVQTLKSELQDAKMSVID
GQLKPLPGESLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVASRETAQALRTLAQ
AARGVAASTKEPQASAAMLDSAQCVMEGSAMLIHEAHQALVHPGDAESQQRLAQVAKAVS
HSLNNCVNCLPGQKDVDMALRSIGEASKKLLVDILPPCSKTFQEAQSDLNHTAAELNHSA
GEVVHSSRGTSGQLAAASGKFSQDFDEFLDAGIDMAGHTQSKDDQIQVIGNLKNISMASS
KLLLAAKSLSVDPGAANAKNLLAVAARAVTESINQLITLCTQQAAGQKECDNALRELEAV
RGLLNNPNEPVNELSYFDCIESVMENSKVLGESMAGISQHCKTGDVLAFGESVAVASKAL
CGLTEAGGQASYLVGVSDPNSQSGHEGLVDPIQFAKAHQAIQMACQNLVDPASSPSQILS
AATIVAKHTSALCNACRLASSKTSNPVARRQFVQSAKEVANTTANLVKTIKASDGDFSDD
NRNRCRVATAPLLGAVENLSTFANNPEFASIPAQISNEGSAAQEPIVRSARSMLDSSTYL
LETARSLVLNPKDPPTWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDYSIDNINKCIR
DIEQASLAAVGQTLPCRDDISMEALQEQLTSSVQEIGHLIDPVSTAARGEAAQLGHKVSQ
LARYFDPLIVASVGLASKLHDHQQQMTILDQSKTLSESALQMLYAAKEGGGNPKASHTHD
AISEAAQLMKEAVDDIMVTMNEAASEGGMVGGMVESIAEAMGRLEEGTPPEPEGTFVDYQ
TTMVKFSKAIAITAQEMMTKSVTCPEELGGLASQVTVDYGQLAHQGRLAAATAESEEVGY
QIKTRVQELGHGCIYIVQKAGALQLSPTDSFSKRELIECARAVTEKVSLVLSALQAGNKG
TQACITAASAVSGIIADLDTTIMFASAGTLSPENEESFADHRESILKTAKALVEDTKLLV
AGAASSQEKLAQAAQSSAKTITQLTEVVKLGATSMGSENPETQVVLINAVRDVAKALAEL
ISATKCAAGKPADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIK
QELTVFQSKDVPDRCTTPEEFIRMTKGITIATAKAVAAGNSAQQEDVIATANLSRKAIYD
MLTSCKQAACHPEVCEELRSKALQYGSECTAGYINLLEQVLQVLHRPIPEQKQQLSLHSK
HVAACVTELVQTAEAMKGSEYVDPEDPTVVAETELLGAAASIEAAAKKLEQLKPRAKPKQ
ADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSNLANAADDGQWSQGLI
SAARRVATATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMK
RLQAAGNAVKRASDNLVKAAQKAAFDKTEDDSVVVKTKFVGGIAQIIAAQEEMLRKEREL
EEARKKLAQIRQQQYKFLPSELREDEG
Download sequence
Identical sequences G3P931
ENSGACP00000014105 ENSGACP00000014105 69293.ENSGACP00000014105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]