SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014147 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014147
Domain Number 1 Region: 190-269
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000408
Family PHD domain 0.0096
Further Details:      
 
Domain Number 2 Region: 95-166
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000731
Family PHD domain 0.0074
Further Details:      
 
Domain Number 3 Region: 42-92
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000403
Family Tudor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014147   Gene: ENSGACG00000010695   Transcript: ENSGACT00000014172
Sequence length 576
Comment pep:known_by_projection scaffold:BROADS1:scaffold_133:131446:136978:1 gene:ENSGACG00000010695 transcript:ENSGACT00000014172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSTCRMFEDLIEAFCGLEPQVAQGGGTCRKGQSPREEAQFSLSVGQFVLCHWSDGLYYLG
KIQRVSPPRLSCFVTFEDNSKFWVLCKDIQHAGVPGEEPRCSVCQEAEPNADNQSNPNNQ
ILICGKCGIGFHQQCHLPPVESSVSLSPWFCRRCVFALAVRKGGALKKGPIAKALSAMKQ
VFPYDLDSLDWDSQHRTNHQQCYCYCGGPGEWYLKMLQCFRCQQWFHEACTQCLQESMMF
GDRFYLFLCSVCNKGSEYVRRLSLRWVDLVHLVLYNLSVSSKKKYFELDEILTLVSASWE
PLQLGKLSHTPPSERGQHLLDALNKYKSKFLCGKEIKKRKCIFRLRTRVPPNPPSKLFPE
RSQSDGGLGHKKRPVRRGSPVVIPFSASAEKRKRKSKWLLEDAIPNSCSWTSNHHMANIF
DFTLDELQSVKRFSCSSRSVSIDQDSTDASTSGSATTSASYHFRRKVGSRKRKLPSNGYK
YWASRSEVGEELRGEEPSRMLEDQEALTHLTADSSHFLSDPTQIPSDSSHLHSSISSYFG
VAGRLTNGETYQVLARRITPQGTVQYLLEWEGTTPY
Download sequence
Identical sequences G3P973
ENSGACP00000014147 ENSGACP00000014147 69293.ENSGACP00000014147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]