SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014186 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014186
Domain Number 1 Region: 24-92
Classification Level Classification E-value
Superfamily UBA-like 0.000017
Family UBA domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014186
Domain Number - Region: 217-335
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0772
Family Apolipoprotein A-I 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014186   Gene: ENSGACG00000010714   Transcript: ENSGACT00000014211
Sequence length 519
Comment pep:known_by_projection group:BROADS1:groupXII:13624473:13634878:1 gene:ENSGACG00000010714 transcript:ENSGACT00000014211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKNQKDASGVVFDTRSKMVMSQGGTADRMKEKISAVRAVVPNKSNNEIVLVLQHFENC
ADKAVQAFLEGSAVEILKEWNVTGKKKPKKKKKPKPQPEASAAPEPPEATPPEEGKDEVN
GFHANGSVVDEESLDSLSEQLDSASLDAVELDSEPATSETTGVLLHSLQNTSKSAEAESH
GSAPSPPLQQAGRNHQVPRGNKIRHRPGSNLHPPTSSSFPPPTDEQGSSGVKRMAPNIDR
SVKDLQRCTASLTRYRIVVKEEMDSSIKKMKQTFAELLSCLMDREVTLLGEMDKVKAEAM
LILDARQKRAEELRRLTDQSASMSEEQLTELRADIKHFVSERKYDEDLGKALRFTFDLEP
LKTSISGFGSVYHPHTGYSNRSRCSSTSSSVASPSLLETPPPTQTQSCSNEHRPPPNKQV
SRESASYIDSLRRSPYSQIFQGNRRTFQGQGYHSGGPRYNGGSYNERNAGRANHRYHSDA
GSSGPAQHSHNSRGPPPSTAPSSNQDRPANNGLPQRPPR
Download sequence
Identical sequences G3P9B2
ENSGACP00000014186 ENSGACP00000014186 69293.ENSGACP00000014186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]