SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014205 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014205
Domain Number 1 Region: 896-928
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000057
Family A20-like zinc finger 0.023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014205
Domain Number - Region: 23-61
Classification Level Classification E-value
Superfamily UBA-like 0.000332
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014205   Gene: ENSGACG00000010734   Transcript: ENSGACT00000014230
Sequence length 930
Comment pep:known_by_projection group:BROADS1:groupXIX:12525042:12540459:1 gene:ENSGACG00000010734 transcript:ENSGACT00000014230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLASTKATAAPWAAHTHDHMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLGAALNDY
EELRQVHTANLPQVFNEGRYYKQPEARDTPTHVSKIDRPCAQKQEDNAQEKRLSRGISHA
SSAIVSLARLQVASECTSEQFPLEMPIYTFQLPDLSMYSEDFRSFIERDLIEQSTMMALE
QAGRLNWWSTMCISCKKLLPLATTGDGNCLLHAASLGMWGFHDRDLMLRKSLYTMMKSGA
ERDALKRRWRWQQTQQNKEDEWEREWNELLKLASSEPRTHLSKNGHTSGGVDNSEDPVYE
SLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGLYLPLEVPPSRCHCSPLVL
AYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLALHFAVDPGRDWEWGRDDNDNTLLA
NLILSLEAKLNLLHNYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAESMDSDRESV
GSNSNVNNGKSGKEKDKDKQRKDKDKGRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHG
KMNKSNAGSGRSAENGGEKTKKKESKATKGNKEESGQSASSTSSEKATSPSPTDRDGPSS
SSPPGRQDSAAREKTLENWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEM
ISYYLTNAQERFSQEQEQRRKEAEKKPPATNEVAAKKPEHESIFQRERSDSSPPPALGLR
VQGRNSPGPAAPLVSVPVVPLTSSPSIGAKRPVAVPVSAHYSHTPPIQRHSVIHLQDVNL
QSSIFQDDPYKPVVGTLKTCATYPQQNRTLSSQSYSPARLSGVRTVNAAETLSYNMPGEH
KSHTYTNGFNAGDIQDCLEFADEDNSSHTWLNQEKTKVRGTGSPLYCFQQRRCKRENCSF
YGRPETDYYCSYCYREEVKRRERESKAQRP
Download sequence
Identical sequences G3P9D1
ENSGACP00000014205 ENSGACP00000014205 69293.ENSGACP00000014205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]