SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014217 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014217
Domain Number 1 Region: 3-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.96e-89
Family G proteins 0.000000000171
Further Details:      
 
Domain Number 2 Region: 520-627
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000292
Family Pleckstrin-homology domain (PH domain) 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014217   Gene: ENSGACG00000010735   Transcript: ENSGACT00000014242
Sequence length 848
Comment pep:known_by_projection scaffold:BROADS1:scaffold_133:172465:188569:1 gene:ENSGACG00000010735 transcript:ENSGACT00000014242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLVNKLQDAFSSIGQNSSLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRG
SGIVTRRPLVLQLINCPTEYAEFLHCKGKKFIDFDEVRQEIEAETDRITGQNKGISPVPI
NLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIENQIREMLMQFVTKDNCLLLAVSPANSD
LANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQK
DIDGRKDITAALQAERKFFLSHPSYRHLADRMGTAFLQKILNQQLTNHIRDTLPALRSKL
QSQLLSIEKEVEEYKNFRPDDPGRKTKALLQMVQQFAVDFEKRIEGSGDQVETYELSGGA
KINRIFHERFPFEIVKLESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRLIAQI
KEPCQKCVDMVINELVNTVRQCTQKLAQFPMLREEMERIVTQHIRDRESRTKGQVMLLID
IELAYMNTNHEDFIGFANAQQKSSQMNKKKAAGNQDEIMVIRKGWLTINNISIMKGGAKE
YWFVLTAETLSWYKDDEGEDKKYMLPCGTPSNSKTSRRVSCPSKHIFALFNTEHKNVYKD
SRQELASESLEEVDSWKASFLRAGVYPERTVDKDKQVEVEEARGDGQIHSLDPQLERQVE
IVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHSDLLAQLYSCGDQNTLMEESQE
QAQHRDEMLKMYHALREGLHIIGDISTSTITTTMPPPVDDSWLQVTGMPSGRRSPMSSPV
PQRRAPPGTPRQGGRSASGPPSRPAMSPDPGTPSIPSRPNRAPPPGVPSRSSKGSPAHGE
SPQSSIEG
Download sequence
Identical sequences G3P9E3
69293.ENSGACP00000014217 ENSGACP00000014217 ENSGACP00000014217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]