SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014230 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014230
Domain Number 1 Region: 666-1056
Classification Level Classification E-value
Superfamily Ras GEF 1.11e-89
Family Ras GEF 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014230   Gene: ENSGACG00000010748   Transcript: ENSGACT00000014255
Sequence length 1062
Comment pep:known_by_projection scaffold:BROADS1:scaffold_133:190777:203665:1 gene:ENSGACG00000010748 transcript:ENSGACT00000014255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKDKLHPQRIKRFEQIKQTPSQTPKPLDLNLQRTLQEKSVCVLADEQRAVISSLQYFK
ALVDRLGVDKQVLDQSVVGGLLGGASSRVLEAVQTLVQLEPHLHNSKTVTSCLTRLYLSL
AQLIRWADEVMLQGIAHGNQDSTASVTLVIRAVLDGVKELVRLAAERRGDSAPLSPVQFG
VTEGQTCVFDDVVKSEGTSAGALAEEDEEKKKTSWAPPKPPMPLTELISFSPPTLPPKRR
QSMGPAPCRVAIVAPMRRETEVNRQSQQNRLRSPLRLSDDTYSCYEQSIHVKVLKNVQLC
KEDAGLKCDSFSSAESAAENTHCGREEEEDPDYNFLLTDSSSFEPPLPLPHPSSLPPNLP
EKRRCSTAITGPTLSQPSSFSFDPPPHEQRPSHCDDDIGPDELGSSPKSPSKTPPPLPEK
KLHIHQYLQFCSTYSAQSAAMFYQRPLTSGQRYSSRQRELETTYRLAHTHLDTQTLDSTP
LPELLPAPVLPAKKRQQVTGFQTRTALIDEWTSVLTSIRIQVDRTRRTRHRTGETQTELR
TLLFLAFGSTFQTLIQYMHKYWGHFPITVPKRRGTCVVNLSYTCRGPVDLSNLIYYTLFV
GKWPNSYSSFVDETSARGPTRQRMSPSAPLLCSLQQEAELKRRSRELQEEVLLTDGQEVL
RRIIMKPQGEDGPDVKAASAEILLVHATMAHSEQVVYREAFLSTFRSFISPEDVIIKLQH
RYHKHLCKQRDPERIAAANNTFHLLVSVVDELCAIELDSNLLLLLMDLVFSLLIGGELRL
ACLLRSNILSKLEQRWHMIGSPQSLRPLAAKGVAARPGTLLDFRSQDLAEQLTLLDSELF
CKIELPEVLLWSKEQNEEKSPNLKEFTQHFNNVSFWVRSVIILQDKSQDREKLLLKFLKT
MKHLRRLNNFNSYLSILSALDSAPLRRLDWQRHTAEALEEFSSLIDSSSSFRAYRAALAE
VEPPCIPYLGLILQDLTFVHLGNPDTLMTSQGSKVNFSKRWQQFNILDTLRSYQQVLVPY
TLQPNDDIISFFNDFSDHLAEEALWELSLRLRPRNAPRANQR
Download sequence
Identical sequences G3P9F6
ENSGACP00000014230 ENSGACP00000014230 69293.ENSGACP00000014230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]