SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014239 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014239
Domain Number 1 Region: 307-384
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-20
Family DIX domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014239
Domain Number - Region: 40-158
Classification Level Classification E-value
Superfamily Tropomyosin 0.0216
Family Tropomyosin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014239   Gene: ENSGACG00000010741   Transcript: ENSGACT00000014264
Sequence length 390
Comment pep:known_by_projection group:BROADS1:groupI:11413542:11421148:-1 gene:ENSGACG00000010741 transcript:ENSGACT00000014264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEARRMVFRLQALLLHGSLPEEDQDGSVSFGDTRANAEQQLVLFRGRLDQSTEEALDLK
RELLRNKQEARHLQAIKDALQQRLGVQEDAVLQIKQELLRSNMAKDQLEVENAELKHRLS
EGNKLLTEYEQQLGRKDRILQQQQQKLDDAQHKAHDVNLGRVRIMMHFKSLNNVLCVNVS
VLMDCCMEINSWSEEENKYFIVLHENKEKSCLCQGEELQLVREALRSLRDSFSGHDPQHH
TLDTLEQGVASLMDRLLTLDSQRRQDRGEEFKSPGRRANSADRDSWPQSSKMAHSLSSPG
LDTTVCTKVLYFTDRSLTPFLINIPKRLGEVTLRDFKVAVDRHGSFRYHFKALDPEFGTV
KEEVFQDGAVVPGWEGKIVAWVEEDHGERR
Download sequence
Identical sequences G3P9G5
ENSGACP00000014239 69293.ENSGACP00000014239 ENSGACP00000014239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]