SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014244 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014244
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily PX domain 1.57e-20
Family PX domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000014244
Domain Number - Region: 116-206
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00861
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014244   Gene: ENSGACG00000010719   Transcript: ENSGACT00000014269
Sequence length 472
Comment pep:known_by_projection group:BROADS1:groupXVIII:10702609:10716958:1 gene:ENSGACG00000010719 transcript:ENSGACT00000014269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFSIPETEVRSGENGSSYVAYNIHVNGVLHCRVRYSQLLGLHEQIKKEYGSNVVPAFPP
KKIFTLTPAEVEQRREQLEKYMQAVRQDPLLGANEMFNSFLRKAQQETQQIPTEDVSLDI
CLSNGQKVTVNILTSDQTEDVLDAVATKLDLPDDLVGYFSLFLIREGADGGLTFVRKLQE
FELPYVSITSLRNSEFHILLRKSYWDMAYDGDVMDNRVGLNLLYAQQTVSDVERGWILVN
KDQHRQLKSLQEKGSKKEFIHLGQTLKYYGYIKFDPCVTDFPEKGCQVIVSAGSNELNFH
VKLPSEQMKEGSFKVTRMRCWRVTSCQVPTANGTTNPCSASKCEVKLELSFEYLMSKDRL
QWVTITSQQAIMMSICLQSMVDELMVKKSGGSIKKMLRKRHNSIQRSDSQQAVKSPPLLD
SPDPNREQIVKLSTKLGSVSLRGISASNSANDISGNDFHGNYAFEGIGDDDL
Download sequence
Identical sequences G3P9H0
ENSGACP00000014244 69293.ENSGACP00000014244 ENSGACP00000014244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]