SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014258 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014258
Domain Number 1 Region: 55-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-21
Family DIX domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014258   Gene: ENSGACG00000010741   Transcript: ENSGACT00000014283
Sequence length 138
Comment pep:known_by_projection group:BROADS1:groupI:11413898:11416266:-1 gene:ENSGACG00000010741 transcript:ENSGACT00000014283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLLTLDSQRRQDRGEEFKSPGRRANSADRDSWPQSSKMAHSLSSPGLDTTVCTKVLYF
TDRSLTPFLINIPKRLGEVTLRDFKVAVDRHGSFRYHFKALDPEFGTVKEEVFQDGAVVP
GWEGKIVAWVEEDHGERR
Download sequence
Identical sequences G3P9I4
ENSGACP00000014258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]