SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014270 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014270
Domain Number 1 Region: 44-192
Classification Level Classification E-value
Superfamily PH domain-like 5.29e-43
Family Phosphotyrosine-binding domain (PTB) 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014270   Gene: ENSGACG00000010781   Transcript: ENSGACT00000014295
Sequence length 201
Comment pep:known_by_projection group:BROADS1:groupXVIII:10747449:10767058:1 gene:ENSGACG00000010781 transcript:ENSGACT00000014295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGNPPAGDRTHLGMDALKSAGRAIIKSPGVPRHTWGTSKHETELPENWTDTKETLLEGMV
FNVKYLGMTLVGQPKGEEMASAAIRRIVSTARAGAKKFRKVTLTVSPKGIIMTDTETTDL
IENVSIYRISYCTADKTQDKVFAYVSQSPFNETLECHAFLCQKKKIAQAVTLTVAQAFKV
ALDMWEIAQEDKNKKARSCCS
Download sequence
Identical sequences G3P9J6
ENSGACP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]