SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014325 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014325
Domain Number 1 Region: 372-610,641-715
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.01e-54
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 7-121
Classification Level Classification E-value
Superfamily EF-hand 8.36e-40
Family EF-hand modules in multidomain proteins 0.00071
Further Details:      
 
Domain Number 3 Region: 188-259
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.63e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 4 Region: 100-185
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000125
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 5 Region: 263-327
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000523
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014325   Gene: ENSGACG00000010810   Transcript: ENSGACT00000014350
Sequence length 729
Comment pep:known_by_projection group:BROADS1:groupXII:13714658:13729731:-1 gene:ENSGACG00000010810 transcript:ENSGACT00000014350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPTQPEVKELNPVDFIQLQQYIEYCRLTVKDVLREFDADGRLARHRHGECINEEGFRL
FLKTYLEVEDFPVDLCQRLFCSFQNSEPTQGDYAKEVFLKDVSCYFSLLEDGQPRDKLEF
AFKLYDRDGNGVLDSSEVDRIIAQMMHAAEYLGWDVSELRPVLKDMMTAIDADSSGTVSL
EEWVEGGMNNVPLLVLLGLKVTQKDGQHLWKMKHFNKPVYCNVCQSMLLGLRKQGLCCTC
CKYTVHGRCANRNPAPCTRTYVKSKKETGVPTHDWVSGNCDSRKCEKCQKKIKSLQGLTG
KHCVWCHTMRHDECADQEPTQCTCGPLRDHILPPWAIYPVIKSLKARKIYNIFTHFALFL
SLKISPVPNTHPLLVFVNLKSGGKQGERVLHKFQYLLNPRQVHNLCNGGPAPGLSFFRNL
QNYRILVCGGDGTVGWILDAIDKANLLVRPPVAVLPLGTGNDLARCLRWGGGYDGEDLSR
ILKDIEGSSQVLMDRWTVQVIPDENQEKGDPVPYEIINNYFSIGVDASIAHRFHTMREKH
PQKFNSRMKNKLWYFEFATSETISASCKKLSESLTIECCGTPLDLSSLSLEGVAVLNIPS
MHGGSNLWGETKKCEAKGMTSQEEPDVIVDPEILKVTSQGPDLSDRRLEVVGLEGAMEMG
QIYTGLKSAVRLAKTSQITIRVKKALPMQIDGEPWMQPPCTIHITHKNQASMLMAPQAKS
AGFFNYNWC
Download sequence
Identical sequences G3P9Q1
ENSGACP00000014325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]