SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014380 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014380
Domain Number 1 Region: 119-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.15e-129
Family Myotubularin-like phosphatases 0.0000000613
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-18
Family VPS36 N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014380   Gene: ENSGACG00000010859   Transcript: ENSGACT00000014406
Sequence length 549
Comment pep:known_by_projection group:BROADS1:groupXVIII:10859415:10865293:-1 gene:ENSGACG00000010859 transcript:ENSGACT00000014406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDGVILHRPFMPTVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDCIEK
RFLGSQGRIIVKCKDLRVIQLDIPGMEECLNIASSIEALSTLDILSLMYPFFYRPMFEVL
EDGWNSFLPQNAFKDLETMTDEWRLSEVNKDFSVCASYPPLVAVPKGVDDDTLRKVATFR
HGGRFPVLSYYHKKNGMVMMRAGQPLAGTNGRRCKEDEKLINATLRPGKRGYIIDTRAAN
VAQQAKARGGGFESEANYPQWRRISKAIERSNILQESLIKLVEALNDQSHNMDRWLSKLE
ASNWLTHVKEILTTACLAAQCIDREGASVLVHGTEGTDSTLQVTSLAQIILDPACRTIRG
FQGLVEREWLQAGHPFHQRCAQSAFSNSKPRQEAPVFLLFLDCVWQIVRQFPCSFEFSDS
FLVLVFEHAYASQFGTFLGNGTAERVKLSLPQKTVSLWSWVNRPQELQRLTNPLYEANSL
VIWPSVAPQSLLLWEGVFLRWNRSSRCQDEAYEEMVHIIEYNKELQSKVNKLRRQLAQLE
TEDRLLQTP
Download sequence
Identical sequences G3P9V6
69293.ENSGACP00000014380 ENSGACP00000014380 ENSGACP00000014380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]