SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014396 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014396
Domain Number 1 Region: 11-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.3e-22
Family Ubiquitin-related 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014396   Gene: ENSGACG00000010872   Transcript: ENSGACT00000014422
Sequence length 178
Comment pep:known_by_projection group:BROADS1:groupXIII:12029617:12032262:1 gene:ENSGACG00000010872 transcript:ENSGACT00000014422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIVLSVFKHHIVSSKMILTVKPLQGKECSVQVTEDEKVSTVKELVSDRLNIPANQQRLLY
KGKALADEHRLSDYSIGPEAKLNLVIRPVGERTGGSGTASSSGCSSASSSSTSQGRVWQT
VSTILARHFSPADAAKVHEQLIKDYERSLRQLSLDDIERLAGRLLHPDGEVMDTSYMD
Download sequence
Identical sequences G3P9X2
ENSGACP00000014396 69293.ENSGACP00000014396 ENSGACP00000014396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]