SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014397 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000014397
Domain Number - Region: 52-224
Classification Level Classification E-value
Superfamily PH domain-like 0.00169
Family Phosphotyrosine-binding domain (PTB) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014397   Gene: ENSGACG00000010874   Transcript: ENSGACT00000014423
Sequence length 458
Comment pep:known_by_projection group:BROADS1:groupXVIII:10910812:10916238:1 gene:ENSGACG00000010874 transcript:ENSGACT00000014423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDDVKKVKKPGIVSPFKRVFLKGEKGRDKKAQEKATERRALHTFSLSQPDHRIDPDILL
NDYIEKEVKYLGQLSSVPGYLNPSSRTEVLQLVDNARKSHQLAGQLTSEQDAVVSLSAYN
IKLVWRDGEDIILRVPIHDIAAVSYIRDDSLHLVVIKTAQESGGSPCPSSCPDLNKSQTL
SSLSEGGAVLVEVCCLLVLAVDNKAAAEELCLLLSQVFQIVYTESTIDFLDRAIFDGATT
PTRHLSLYSDDSSSKVDVKEAFEEEASAFPFQASMEAEGNSPSASTPASPQAKTASDGDL
STTAAELLQDYMTTLRTKLSSQEIQQFATLLHEYRNGASIHEFCINLRQLYGDSRKFLLL
GLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRYRRTASSASDSTANGNGAAGGSGA
SDEGQEAPEGDEWDRMITDISNDIEALGCSMDQEGATP
Download sequence
Identical sequences G3P9X3
ENSGACP00000014397 69293.ENSGACP00000014397 ENSGACP00000014397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]