SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014408 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014408
Domain Number 1 Region: 170-312
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-35
Family Third domain of FERM 0.0036
Further Details:      
 
Domain Number 2 Region: 67-172
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-30
Family Second domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014408   Gene: ENSGACG00000010873   Transcript: ENSGACT00000014434
Sequence length 514
Comment pep:known_by_projection group:BROADS1:groupXIX:12882844:12894647:-1 gene:ENSGACG00000010873 transcript:ENSGACT00000014434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEVTKSIAKQMKCQPPFTMCLR
VKFYPPEPAFLKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAHILQAEIGNYDPGKH
PEGYSSKFQFFPKHSEKLERRIADIHKTELIGQTPETSERNFLQKAQMLETYGVDPHPCK
DVSGNPAFLAFTPFGFVVLQGNRRVHFLKWNELTKLKFEGKTFHIYANQKEDKKIILTYF
APTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRFSGRVAKEVMEQSAK
IKREPPEIHRAGLVPSRSCPSITHGPRLTSVPRTRRRAVHISIMEGLESLRDSAHSTPVR
SVSHGECFIPRSRSQAAGAGERSAVISDEAYSPSDSVLPTPVGEHGAEVSGSRQSNGAPR
SIEEEKESEAGTPSHAEAGDFGAAEEAAGGDSALGEVEQVNKFVLSTESDLDVAFLRDIR
QTPEFEQFHYEYFCPLRRWFACKLRWAGGLLINK
Download sequence
Identical sequences G3P9Y4
ENSGACP00000014408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]