SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014441 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014441
Domain Number 1 Region: 559-806,847-963
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 8.63e-126
Family Oxysterol-binding protein 0.00035
Further Details:      
 
Domain Number 2 Region: 13-228
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.02e-38
Family Ankyrin repeat 0.0006
Further Details:      
 
Domain Number 3 Region: 249-361
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000459
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014441   Gene: ENSGACG00000010903   Transcript: ENSGACT00000014467
Sequence length 968
Comment pep:known_by_projection scaffold:BROADS1:scaffold_211:760:11597:1 gene:ENSGACG00000010903 transcript:ENSGACT00000014467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMEEPEEQFLQFARNGDLPGLQRLLLSTMREETHININCRGTAGKRKSNLGWTPLHLASY
FGHKDVVEELLKVGADVNLPNNVGDTALHKAAFTGRKEVVMLLLHYGACAAVINGTAQIP
KDVTQSAEIRGMLEDHFAKKQAAQRTEERKQEEELLEAAREGDLSTLTRLLSRKKSPDIN
CTDLLGNTPLHSAAYRGQRPCVLKLLRGGASANVENNKGQTALDLASSAAIKLVLEGTAH
RGGTRHVKKHQGLLWKSSRFFGWRSYWVVLQDGVMSWYSKQSDAASNVSRQGCKSLTRSQ
CLVRDKDSCFFTLKCFDDSLHHFKVSPKSDPEATAKAWLQAVEEHSAYSTHYCSQEQGSE
EEEHEEEAKSLGELTESLQAAEAHQEELEEEVEALVSMLRDGGLAESFPSTVTQKLQEIR
VLSGETSACLRVCLGLLSRQEVVRSLRLEQQVEKNRILSEALQTLATEHHQLEQSVVGGP
PPPSEDEFHDAVSGSSWGRSLAHTLVLLCARLHHLASWHQSIGYISYRTIRLKSAGGGQR
RSRLLNIDRSRTSLPAPMFSRNDFSIWSILRNCIGMELSKITMPVIFNEPLSFLQRLTEY
MEHTYLLQRANACPDSTQRMKCVAAFAVSAVASQWERTGKPFNPLLGETYELLPREDLGF
RLLSEQVSHHPPVSAFHAEGLQQDFVFHGSIYPKLKFWGKSVEAEPKGLITLELPKHNEA
YTWTNPTCCVHNIIVGQLWIEQYGTMELLNHRTGEKCCLNFKPCGLFGKELHKVEGHILD
KSRKKLCALYGKWTECLYAVEPAAFEAHKKSDKKATAQKKGGKAVGSSGALEEVPSPAAD
TVEMIPGSQLLWRIAPRPANSTQMYSFTSFAMQLNELHTEMEASLPRTDCRLRPDIRAME
NGDIDVASEEKKRLEEKQRATRKDRSKCDEEWKTRWFQQGPNPHTDSQDWLFCSAYWDRK
YSQLPDIY
Download sequence
Identical sequences G3PA17
ENSGACP00000014441 69293.ENSGACP00000014441 ENSGACP00000014441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]