SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014504 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014504
Domain Number 1 Region: 216-396
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.13e-33
Family Phospholipase D 0.043
Further Details:      
 
Domain Number 2 Region: 518-727
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.87e-30
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 1-113
Classification Level Classification E-value
Superfamily PX domain 0.00000000000288
Family PX domain 0.0081
Further Details:      
 
Domain Number 4 Region: 124-227
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000215
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 457-511
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000408
Family Phospholipase D 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014504   Gene: ENSGACG00000010958   Transcript: ENSGACT00000014530
Sequence length 862
Comment pep:known_by_projection group:BROADS1:groupXV:10080151:10093936:1 gene:ENSGACG00000010958 transcript:ENSGACT00000014530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFKIELKHGEFTWVVKRKEKHFMELHRELRTYKTFMRIPLPSRSHTVRRRTARKSEVREM
PSLPRGGGDELVRDEQVSSRRRQLEDYLNKLLRMAMYRKYHHTMEFIDISQLSFIHDLGP
KGLEGMIYKRSGGHRIPGMNCCGHSPACYRWSKRWLVVKDSCLLYMKPDSGAISFVLLVD
KEFSIKMDSKDTEHKYGVRIESLSRTLVFKCSSYRHARWWGQSIESFVRSHGKPFLRDHR
CGSFAQEQENIPAKWYVNGKTYMEDVADALEEAKEEIFITDWWLSPEIFLKRPVVEGNRW
RLDCTLKRKAQQGVRIFVMLYKEVELALGINSGYSKRTLSHLHPNIKVMRHPDHVSSSVY
LWAHHEKIVVVDQSVAFVGGIDLAYGRWDDSEHRLTDVGSVTRSVALEQHADSVSSVDSA
GVGELQGNTRFWHGKDYCNFVYKDWIQLEKPFDDFIDRYTTPRMPWHDIASVVHGRAARD
VARHFIQRWNFTKIMKPKYRSLSYPFLLPKSHSSADDLRYQVPDCVNARVQVLRSAADWS
AGIKYHEESIHTAYVHVIAKSKHYIYIENQFFISCADNRTVYNKIGDAIIERILRAYKEG
KKYRVYVVTPLLPGFEGDITTGGGNAIQAVMHFNYRTMIRGEYSIISQLKKEMDDHWMNY
ISFAGLRTHTELEGRLVTELIYVHSKMLIADDNTVIIGSANINDRSMLGKRDSEVAVIVE
DSEKVAGVMDGQEYEAGPYALQLRLECFRTVLGGHTDSSIDMSDPISDRFYKEVWMTTAG
RNATIYEKVFRCLPSSLVRNMSELEQYQSKPGLAQTDLARAQEELRKIRGFLVQFPLDFL
SEQNLMPSVGTKEAMVPTEIWT
Download sequence
Identical sequences G3PA80
69293.ENSGACP00000014504 ENSGACP00000014504 ENSGACP00000014504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]