SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014584 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014584
Domain Number 1 Region: 79-273
Classification Level Classification E-value
Superfamily Sec7 domain 5.63e-80
Family Sec7 domain 0.00000000928
Further Details:      
 
Domain Number 2 Region: 281-401
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-33
Family Pleckstrin-homology domain (PH domain) 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014584   Gene: ENSGACG00000011019   Transcript: ENSGACT00000014610
Sequence length 417
Comment pep:known_by_projection group:BROADS1:groupXI:9080011:9104314:-1 gene:ENSGACG00000011019 transcript:ENSGACT00000014610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVSKLCGSSLQTFLCPAVKPLQPPPVPDDLTPQEKQELEDIRRRKQELMEDIQRLKDE
IAEVTSEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTSDDIAQF
LYKGEGLNKTAIGDYLGERDDFNIEVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQK
IDRMMEAFAQRYCRCNPGVFQSTADTCYILSFAIIMLNTSLHNPNVKDKPSVERFISMNR
GINDGGDLPEDLLRNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKR
RWFILTDNCLYYFEYTTDKEPRGIIPLENLSIKEVEDKKPNCFELFIPDNKDQVIKACKT
EADGRVVEGKHNFYRISAPTAEEKEEWMNSIKAAISRDPFYDMLAARKKKVSSMKRH
Download sequence
Identical sequences G3PAG0
ENSGACP00000014584 ENSGACP00000014584 69293.ENSGACP00000014584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]