SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014590 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014590
Domain Number 1 Region: 352-716
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-116
Family Oxysterol-binding protein 0.0000167
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-18
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014590   Gene: ENSGACG00000010999   Transcript: ENSGACT00000014616
Sequence length 722
Comment pep:known_by_projection group:BROADS1:groupVIII:13788640:13811061:1 gene:ENSGACG00000010999 transcript:ENSGACT00000014616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTGAVIGIDDEDDSTFTITVDQKTF
HFQARDADEREKWIHALEGTILRHTLQLQEAETGLVPSVQDFDKKLAEADAYLQILIDQL
KLFDDKIKDCTEDESRSKIETLKETTCSMVESIKHCIVLLQIAKDQSNEQQHANGLISTI
NPVDGIYQPSLEPPIVNTTMPTQTTLPADASQVCKSDVRPSTLSVGPVVTVMGSLQTPTP
NSTGSGPSGPSSGIASPTHIPLPSHSVPDFSYSSSEDEFYDADEFYQSSTSPKHCIDPSG
PQAASLLTNEAMGLKRPNTTESLNSSMSNGTTDADQFDHEDRDDDGEGESVEEHKSVIMH
LLSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSIAEQLEARDRMVHVVKWY
MSAFHAGRKGSVAKKPYNPILGEVFYCHWDLPSETDEPSPNAETVSEGPVPWSSSNSVCF
VAEQVSHHPPISAFYAECLNQKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLEHDEHYV
LTFPNGYGRSILTVPWVELGGECNISCSKTGYSANIVFHTKPFYGGKKHRITAEIFPPND
KKSFCSIEGEWNGVMYAKWATGENTVFIDTRRIGIIKKKVRKLEDQLDYESRRLWRDVTL
NLKQRDIDAATDAKHRLEEKQRAEARERKENEQQWETRLFHEDGECWVYDEPLLKRLASQ
RP
Download sequence
Identical sequences G3PAG6
ENSGACP00000014590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]