SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014601 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014601
Domain Number 1 Region: 894-993
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-26
Family PDZ domain 0.00038
Further Details:      
 
Domain Number 2 Region: 291-393
Classification Level Classification E-value
Superfamily PDZ domain-like 9.86e-24
Family PDZ domain 0.0000515
Further Details:      
 
Domain Number 3 Region: 730-827
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-23
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 4 Region: 586-693
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-23
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 454-545
Classification Level Classification E-value
Superfamily PDZ domain-like 1.21e-16
Family PDZ domain 0.00019
Further Details:      
 
Domain Number 6 Region: 18-89
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-16
Family Nucleotide and nucleoside kinases 0.0036
Further Details:      
 
Domain Number 7 Region: 187-223
Classification Level Classification E-value
Superfamily WW domain 0.00000000000623
Family WW domain 0.0017
Further Details:      
 
Domain Number 8 Region: 234-268
Classification Level Classification E-value
Superfamily WW domain 0.00000000167
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014601   Gene: ENSGACG00000011034   Transcript: ENSGACT00000014627
Sequence length 1014
Comment pep:known_by_projection group:BROADS1:groupXII:14257749:14287809:-1 gene:ENSGACG00000011034 transcript:ENSGACT00000014627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKVLNTDLHHYLSLQFQKGSLDHKLQQVIRDNLYLRTIPCTTRQPREGEVPGVDYNFISV
GEFRDLEESGLLLESGTYDGNYYGTPKPPAEPSPVQPDLVDQVLFDEEFDSESSRGRRVT
LVKKNSERATAHPTSKSKREKRFSMPASFSPCRAAEHKEQAEWRKTVPSYNQSAAAMDVR
VWTTPDEGQEALPKKWEMAYTETGMVYFIDHNSKTTTWLDPRLAKKAKAPEKCVEGELPY
GWEKIEDPQFGTYYVDHINQKTQFENPVQEAKRNEQNARTVAEEPSRGARAFTRDPSQLQ
GSILQAALRKSSQGFGFTIIGGDRPDEFLQVKNVLPDGPAAHDNKIASGDVIVDINGACV
LGKTHADVVQMFQSIPINQYVDMVLCRGYPLPEDSSSTEESSKDTSPSPSASTQQDPHQT
IPDGGTLSRQTAAVPPMTNGGLPPVPNQEGPDPTLLQPELVSVPLVKGPGGFGFAIADCP
LGQKVKMILDAQWCRGLLKGDVIKEINRQNVQTLSHSQVVDILKDLPVGSEVSVLVLRGG
HTSPVKSLKPQEILSSIEALGPSELVPNPLPFPANTLRVSSPKPDASELYIKSKALLDSK
PPNTKDLDVFIKRNQESGFGFRVLGGEGPDQPVYIGAIVPLGAAEKDGRLRAGDELLCID
GVPVKGRSHKQVLELMTNAARNGQVLLTVRRKLTQTDGEEEESAQQPPRVASALVNSSPK
MPRVEVPDAVQSSRPECFDVTLQRKDNEGFGFVILTSKNKPPPGVIPHKIGRIIEGSPTD
RIGQMKVGDRISAVNGLSIMELSHNDIVQLIKDAGNCVTLTVVPEDDSAPPSGTNSAKQS
PSAQHRAMGQQPPSYPDSISYMFSSQNEPNTTKHISYPQYVVHIIMSDKTMSWSQKSHIS
DCELQGCFVVELDRSQRGFGFSLRGGKEYNMGLFILRLAEDGPALRDGRIHVGDQIVEIN
GEATQGITHTRAIELIQAGGSKVHLLLRPGQGLVPDHSQNSSSTLCFYMKPEHH
Download sequence
Identical sequences G3PAH7
ENSGACP00000014601 69293.ENSGACP00000014601 ENSGACP00000014601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]