SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014603 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014603
Domain Number 1 Region: 3-112
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-18
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014603   Gene: ENSGACG00000011012   Transcript: ENSGACT00000014629
Sequence length 225
Comment pep:known_by_projection scaffold:BROADS1:scaffold_211:40962:43709:-1 gene:ENSGACG00000011012 transcript:ENSGACT00000014629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVKSGWLHRQSTILRRWKRNWFDLWADGRLVFFNDQQRCDMEDELHMRVDCINIRGAA
ACPELNAPEAKVRDALFQIVCRDGRVVSLCAESADDALAWTMALQDARINTVVSTPQVTF
AQEVRPSAPPPYSDYAPPPQQVFAPAPYGDFVAAPPPHAAQIVYSPDGQPYAVAYPYQYP
GVYGGPGANGGVMRERQWEDGGDVALGMLAGAATGLAIGSLFAVF
Download sequence
Identical sequences G3PAH9
ENSGACP00000014603 ENSGACP00000014603 69293.ENSGACP00000014603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]