SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014629 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014629
Domain Number 1 Region: 166-240
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.11e-24
Family PHD domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014629   Gene: ENSGACG00000011045   Transcript: ENSGACT00000014655
Sequence length 241
Comment pep:known_by_projection scaffold:BROADS1:scaffold_211:44069:47210:1 gene:ENSGACG00000011045 transcript:ENSGACT00000014655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAIYLEHYLDSIENLPCELQRNFTLMRDLDNRTEEKKGEIDQLAEEYVVKVKNFASEQ
RVEHLQKIQNAYSKCKEFSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLELSGY
ESTEGRSVKKPETRGLRDKRASRGRAKKASDEDSPKKKKIKNSPELSDALLPMQPSDVLD
MPVDPNEPTYCLCHQVSYGEMIGCDNPDCTIEWFHFACVDLASKPKGKWFCPRCTQDKKK
K
Download sequence
Identical sequences G3PAK5
ENSGACP00000014629 ENSGACP00000014629 69293.ENSGACP00000014629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]