SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014700 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014700
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-90
Family Calponin-homology domain, CH-domain 0.00000344
Further Details:      
 
Domain Number 2 Region: 301-422
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-34
Family Spectrin repeat 0.0000716
Further Details:      
 
Domain Number 3 Region: 608-747
Classification Level Classification E-value
Superfamily Spectrin repeat 7.68e-32
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 4 Region: 1016-1173
Classification Level Classification E-value
Superfamily Spectrin repeat 5.2e-27
Family Spectrin repeat 0.0000416
Further Details:      
 
Domain Number 5 Region: 1869-2024
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-25
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1561-1705
Classification Level Classification E-value
Superfamily Spectrin repeat 3.5e-25
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 2183-2298
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-24
Family Pleckstrin-homology domain (PH domain) 0.0000929
Further Details:      
 
Domain Number 8 Region: 1229-1382
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-23
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 9 Region: 1494-1600
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-22
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 10 Region: 822-956
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 11 Region: 431-533
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 12 Region: 535-641
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-19
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 13 Region: 751-853
Classification Level Classification E-value
Superfamily Spectrin repeat 4.16e-18
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 14 Region: 1711-1813
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-17
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 15 Region: 1384-1498
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000662
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 16 Region: 2011-2090
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014700   Gene: ENSGACG00000011100   Transcript: ENSGACT00000014728
Sequence length 2347
Comment pep:known_by_projection group:BROADS1:groupXV:10442747:10472910:-1 gene:ENSGACG00000011100 transcript:ENSGACT00000014728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAAMTSTTDFDNAEISQQYSRINTRFDLADEDLDNDNCSARLFERSRIKALADEREAVQ
KKTFTKWVNSILSRVGCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENV
DKALQFLKEQRVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQKETRS
AKDALLLWCQMKTAGYPNVNITNFTTSWKDGMAFNALIHKHRPDLLDYNNLKRSNPTHNL
HSAFNVAEQQLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKQLAVEGKRVGKVL
DHAIETEKMIDKYETLASDLLPWIEQTIVVLNNRKLANSLSGVQQQLQAFNTYRTVEKPP
KFQEKGNLEVLLFTIQSRMRANNQRVYTPKEGALVADINRAWERLEKAEHDRERVLRDEL
IRQEKLEQMARRFDRKAAMRETWLLENQRLVAQDNFGYDLPAVEAAKKKHDAIETDISAY
EERVQVLVDISKELESERYHDAKRVDVRKDNILRLWDYLQELLKARRARLDKNLTLQRLF
QEMLYIISWMDDMKARLLSPDFGKHLLEVEDLLQKHTLLENDIALQAERVHGASAAALKF
ANGDSYKPCDPQVIRDRVQHLDLCYQELCALAAQRRARLDQSRLFWNFLWEVAELESWIR
EKEHIFSSLDYGKDLTSVLVLQSKHSAFEDELGARRANLDQVLAAGDKMIQAKHFGSPKV
QECMHDISRQWQQLEELAAFRKQSLQDTHKFFQFQGDADEFKAWLLDAKRQMSSDDMGHD
EYTTHRLLNKHKHLKNETIKNGATIDALSKQANALPEELQNTPDIQRRLKDIKDLYMELM
SLADLRQKKLDDAMALYTIFSETDACELWMGQKETWLVGLEVPEKLEDLEVVQNRLSILA
QDMANVQSRVDDVNKAVKQLEDSRHPRTKEVKECQLRLNKRWEAFKALVEDKKRKVDSAV
SLNNYGLECDETETWIRDKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIENKITFL
RNEADQLATDHPENAQDILARRGELEAAWDALKKTLKDREDSLGEVSKLQTFLQDMDDFQ
SWLFKTQKAVASEEMPASLPETEEQLSLHDAVREDIANREEDYHRVRDTGAQVTQGQEDD
PQYQQLEQRLKGLDRGWVELQKMWDNRKNFLDQGLGFQQFMRDGKAVEAILNNQEYTLAH
IDEPDNLAGAEKALKKHEDFVSTMEANEDKIDGALQGGQRLVDGSNLYSGKVQDKMGSIR
DRNNKNKRRAREVSEKLNDNRDLQHFLQNTQDLTVWINEKMLTAQDTSYDEARNLHSKWL
KHQAFMAELASNKDWLNKVDQEGQELTESKPEFEPIVTERLAKLHELWDRLESTTQEKAR
LLFDANRSELYDQSLTDMRKWLGGLQQQLQSGDQDVKDLTKANILLKKHQMTEKQVRDRA
RELEELQEAVRKHSGGREDQADIEAEQQALQRDFQQLLTPLAQRKGKLEAAKAVHQFYRD
LADELLWIEERMPQAMSQEHGHNLQTVQMLLKKNQTLQREIEGHQPRVDEVLERGARMAS
AASAEGRPEAERLAEQLRELEEAWVRLQGEVAKRRERLSGASLAQHYYNDADEAEAWIGE
QELYMITEEKAKDEQSAMLMLKRHMTLKQAVDDYSDSVQSLADRAQKMFAEHHPDGEEII
RRQGQVDKQYAGLKELAEDRRRKLDHTYHHFLLSREVEELEHWIAERDMVASSQEMGQDL
DHVTLLRDKFREFARETGTVGQERVDLVNEAIDELIEAGHAEAANMAEWKDTINESWADL
LELIDTRAQLLTTSYELLKYFDDGKELVTQIHEKQTELPDDVGEDFSKAESFHRMHAAFE
RDISALGKQVQHFQETASRLHAQYAGGRADAIQRTEQEVVEAWKGLLDACDGRRAQLVDT
AEKFRFFTAVRDLMAWMESIIQQIETQEKPRWDVSSVELLQKYHQGIRSEIEAREAKFTD
CMELGKALLTRKHRDSAEIKEKLVQLIEKRKEMMFKWDDRWDWLRLLLEVCQFARDASVA
EAWLIAQEPYVSSRDLGRTVDEVEKLLKRHEAFEKSTATWEERFSALERLTTLELLEKSN
APIRREDTGFGEESSQLGTIEEQTLSGSGAVEPSSGPPEETAGDFTVPKGSEMRASGSLE
LEPSVSVATPTEPERAATMPVEPHRAQAVLQEGTLSRKHAVEGSGKKTSNRSWNNLYCVL
KPGQLSAYKDAKSFGHGVTFHGEDPLSLSSATWEFLTSYKKKKHVSKLRLGDGSEYLFQF
KDEEELQRWSQAMEKAVQPLAAAEEAAASGAKTHSLPPPASSSTAPPEPSSAKKDKEKKS
SRFAKNK
Download sequence
Identical sequences G3PAS6
ENSGACP00000014700 69293.ENSGACP00000014700 ENSGACP00000014700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]