SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014730 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014730
Domain Number 1 Region: 539-655
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.89e-30
Family UBX domain 0.0000542
Further Details:      
 
Domain Number 2 Region: 339-492
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000313
Family Thioltransferase 0.037
Further Details:      
 
Domain Number 3 Region: 104-179
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000377
Family Ubiquitin-related 0.012
Further Details:      
 
Domain Number 4 Region: 191-265
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000368
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014730   Gene: ENSGACG00000011131   Transcript: ENSGACT00000014758
Sequence length 657
Comment pep:known_by_projection group:BROADS1:groupVIII:13888734:13937931:1 gene:ENSGACG00000011131 transcript:ENSGACT00000014758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGGESNMDREMILADFQRLALGIDNIAEAITLLELNNWDLVAAINGVIPQENGILQSNFP
SEASQASAFGPPSQSEAADAAVAAGGAASAFCPVNPSSRHIVERQPRMLNFRVEYRQRTI
ELVLEEGSTVGEIKTILEADLGIPVSKMQLKGWKSGDVSDSTVMRSLHLPKNNSLYVLTP
EIAPTASTSKNSDLQDSLNQNFLLVISHREAQRDYSLNFPGSRTIQEVKRNISDLTNIPV
RHQQWDGWPASASDDSMTLAVSGISYPCHHLSVCRRSSPANSQEPTEECADVHMVSDSEG
DDFEDASEFGVDDSEMFGMGSSTCRKSPMMPENSENEADALLHFTAEFSSRYGETHPMFF
IGSLEAASQEAFYGKARDRKLLAIYLHNDDSVLSNVFCSQMMCADSIVAYLSQNFITWAW
DVTKEANKARLLTMCTRHFGSVVTQTIRTYKTDQFPLLLIVMGKRTSNEVLNVIQGNSTV
DELMMRLMGAMEIFTAQQQEDIKDEDEREARETVKREQDEAYRVSLEADRKKREAQEKEE
AEQVRLERMRKEQEDEKEAIRLSLEQTLPAEPDEDSAEQISKLRVRTPSGQFLERRFLGS
CKLQVLFDFVASKGFPFEEFKLLTTFPRRNITQLDPGSTLLEAKLFPQETLFLEAKE
Download sequence
Identical sequences G3PAV6
ENSGACP00000014730 ENSGACP00000014730 69293.ENSGACP00000014730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]