SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014737 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014737
Domain Number 1 Region: 407-598
Classification Level Classification E-value
Superfamily Sec7 domain 3.79e-63
Family Sec7 domain 0.00000475
Further Details:      
 
Domain Number 2 Region: 630-754
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000406
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014737   Gene: ENSGACG00000011143   Transcript: ENSGACT00000014765
Sequence length 847
Comment pep:known_by_projection group:BROADS1:groupXVII:11717942:11726914:-1 gene:ENSGACG00000011143 transcript:ENSGACT00000014765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVEMLERKYGGRFITRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQ
FSFEGPEKVHSSYFEGKQVSLTDDSTKIGALVQSELGGEMGLQAKTPTTQSDFTDAISEL
EDAFSRQVKSLAESIDDALNCRSLHGDDNQSEPGIAHQDMDREVSCQVKPSRGASEHRKL
DEMTASYSDVTLYIDEEELSPPLPLSQSVDRPSSTESDLRQRSLNSSQDYWSLAHKDDKG
DTDTSCRSTPSLECQEQRLRVDHLPLLTIEPPSDSSVELSDRSDRSSLKRQSAYERGHGN
QQSSPKNIGLPPRGPPRDEEAARHRPRQLEAHLAINGTANRQSKSESDFSDGDNDSINST
SNSNDTINCSSESSSRDSLREQTLSKQTYHKETRNSWDSPAFSNDIIRKRHYRIGLNLFN
KKPEKGIQYLIERNFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDE
MDFSAMELDEALRKFQAHIRVQGEAQKVERLIEAYSQRYCICNPGVVRQFRNPDTIFILA
FAIILLNTDMYSPNVKPERKMKLEDFVKNLRAGVDDGEDIPREMLVGIYERIRKRELKTN
EDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQ
REIFLFNDLLVVTKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGVRLTSAIPGAD
IKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKYRIESELEKQKGVVRPIMSQCSGLKK
DTGNGNLSRGSLDDSYAVVEGLKRSALSSSLRDLSDAGKRGRRSSAGSLDSNMEVSRTQP
TPGRLCV
Download sequence
Identical sequences G3PAW3
69293.ENSGACP00000014737 ENSGACP00000014737 ENSGACP00000014737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]