SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014740 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014740
Domain Number 1 Region: 46-94
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.32e-18
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 248-298
Classification Level Classification E-value
Superfamily UBA-like 0.00000000408
Family CUE domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014740   Gene: ENSGACG00000011145   Transcript: ENSGACT00000014768
Sequence length 311
Comment pep:known_by_projection group:BROADS1:groupVIII:13948367:13950370:1 gene:ENSGACG00000011145 transcript:ENSGACT00000014768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRQEHPAVSSASQVHSAAGASIPVSMAGTLLRGPPLILRASDKYPRTPKCARCRNHGV
VSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQLLYGTAEG
LALAAANGIIPPRPNYEVFTCVNSESNSDSSVQKYELFPKSQLSGSAASQQNSGKPASTE
SDSAPGISSPDGRHGGSGSENGDSESFISSPVSKPLKDGGETPRSVSSLGSDSGSETDKD
EQEPSPSSAASRHMNAIDILTRVFPSHKRSVLELVLQGCGKDVVQAIEQILNNGSNKAGA
DETWTAERVLQ
Download sequence
Identical sequences G3PAW6
ENSGACP00000014740 69293.ENSGACP00000014740 ENSGACP00000014740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]