SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014774 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014774
Domain Number 1 Region: 356-579
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-49
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 584-715
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-23
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 114-202
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-16
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014774   Gene: ENSGACG00000011168   Transcript: ENSGACT00000014802
Sequence length 1022
Comment pep:known_by_projection group:BROADS1:groupXII:14799331:14819560:-1 gene:ENSGACG00000011168 transcript:ENSGACT00000014802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCGKNESQVCHHPDCQDLNNKSPLHLCESCDSRSHSENTDNMHFDRHPRFDLQPQASILA
RNVSTRSCPPRTSPPSDLEEEDEGSSDRGERKAGGLKMAKKKTRRRHTDDPSKECFSLKF
DLNVDINTEIVPAMKKKTLSEVLGPVFERNGIELSRVDLFLDQSNTPLSLNFEAYRFGGH
YLKVKARLGDELKVEQGVKDLRSLSLPNMKPSGGQSPYILTPGGERAEHGSLGRREAVDL
LGQARRRKNMTEFLGEPNIPTPDTLGQLGGSLPGTGPDSWKNRAASRFSGFFSSTGGVGP
FGKEADRLEQLQSKLHSYTLFGLPKVPQQLSFHQDSWEEEEESNLVLEDSWKMLLDDSES
LTRRQFQQQEAIWELLQTEATYIKKLRVITDLFLCGLLNLQESGLLTEVEPAKVFSNIHE
IIRLHTLLWNQVMLPVLEKARQARALLDPTDLHHGFRTFGTRFQPYIRYCMEEEGCMENM
RTLHRDNELFRTYVTWAETDKQCNRLKLADMLAKPHQRLTKYPLLLKSVMKKTDEPSARD
IVNSMVAAVEGFINSVESQMRQSQEKQKLATISARIDSYEAVEGSSEEVEKILKEYNRFD
LMAPMRGISPEETRQLHLEGALRMKEGKDSRMEVYCVLFTDQLLITKPVKRVEKVKIIRQ
PLLIHNVVCKELKDPGSFILIYLNEFKNAVGAYTFQANSATQGRSWIDAICNVQNQLLRL
RTEEVLRQQNARSRCKEGEDEEEEEDESSNSTTSSPCLRHTVQQNSSQSDGSTETLSVMD
VDEPGEPQKPLFPNTNQQGTSVKDSEAALLSEVQQLQPKGAPTVHRSLSIDSAYGTLSSK
SLLRDLQPLPGDSLGSQLLVVQSSKPRRRPHVQSRVHCLQRLSGLALSRSEDNLLQRLYS
RSPASHAHGSKADLDRSEDCLSLSSDKLRATLRRAEPKRRQKGSAGLREGDGSQSNSSDG
ETAPSPCGERRNESKATGDSGEKALQKKSSSPPQQHKKLTLAQLYRIRTTLVLNSTLTAS
EV
Download sequence
Identical sequences G3PB00
ENSGACP00000014774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]