SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014868 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014868
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.35e-76
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 389-506
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.35e-43
Family Pyk2-associated protein beta ARF-GAP domain 0.00018
Further Details:      
 
Domain Number 3 Region: 248-357
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-28
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 4 Region: 660-779
Classification Level Classification E-value
Superfamily Ankyrin repeat 7e-25
Family Ankyrin repeat 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014868   Gene: ENSGACG00000011244   Transcript: ENSGACT00000014896
Sequence length 824
Comment pep:known_by_projection group:BROADS1:groupXII:14986335:15008180:-1 gene:ENSGACG00000011244 transcript:ENSGACT00000014896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRANIDEVETEVVEIEAKLDKLVKLCSGMIEAGKAYVSANKLFVNGIRDLSQQCKKDETI
SECLEKCSESLQEIINYHMILFDQAQRSVKQQLHNFVKEDVRKFKETKKHFDRVREDMEI
AQVKNAQAPRNKPHEVEEAGGTLSITRKCFRHLALDYVLQINVLQAKKKFEILDAMLSFM
HAQYSLFQQGYNLLDEIDPYMKKLATELDQLVIDSAMEKREMEHKHATIQQRTLMQDFSY
DDSKVEFNVDSPNGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVYQKKLKDSLTVVVED
LRLCSVKPCEDIERRFCFEVLSPSKSCMLQAESEKLRQAWIQAVQASIASAYRESPDTYY
IEHLDRTASPSTSSIDSASEPRERSVRGETILQRIQCQPGNEHCCDCGQADPRWASINLG
ILLCIECSGIHRSLGVQCSKVRSLTLDSWEPELLKLMCELGNGVINHIYEGSYQEQGLKK
PLPSSSRQEKEAWIKAKYVEKKFLKKLGSTEILINGVRKSERRWSVKKCRRHNSATMVPK
TRRRYRQEPGTTSPSGLSSVTRVCLTAAAKFRRDSLFCPDELDSLFSYFDTGSGPRSLSS
DSGLGGSTDGSTDILVFGSVVGSVTEECEASEDSSGEAELEVEPETSDPEDTRVLHPGAL
LCKASKARNLPVMAEALAHGADVNLVNDEDEGKTPLIQAVMGGSLIACEFLLQNAADVNQ
RDARGRGPLHHATYLGHTGQVCLFLKRGATQNDGDEDGQDPLSIAVQQANADIVTLLRLA
RMNEEMRESEGPFGQPGQYPTSSPTEQQYKRCIQEFICLNIAQC
Download sequence
Identical sequences G3PB94
69293.ENSGACP00000014868 ENSGACP00000014868 ENSGACP00000014868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]