SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014875 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014875
Domain Number 1 Region: 14-67
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000448
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 92-153
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000709
Family PHD domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014875   Gene: ENSGACG00000011252   Transcript: ENSGACT00000014903
Sequence length 268
Comment pep:novel group:BROADS1:groupXII:15033859:15036716:-1 gene:ENSGACG00000011252 transcript:ENSGACT00000014903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKSTVSDAVCGEDADKCYICLSPFEKQVVASLEKCQHVFCLECILQWSQTANTCPVDRT
TFDSIQQRRRPGGAVRKKIKVKTNKREDDYDEEEEEEEEGNNTVICEECGRGDRRHRLLV
CTRCDSGYHTDCLTPSSDSGPGGDWICAQCAVTPQHADELTVEGEISDGELTDLLAEVDE
SASTSTRLRPSSSHRPSSSADRRHSQRLQSTAGADPPPRPRSSWHVPRHLLRAAEPAGTT
EGGAQLRHSGGSSAAFKIKRRKSRKRAT
Download sequence
Identical sequences G3PBA1
ENSGACP00000014875 69293.ENSGACP00000014875 ENSGACP00000014875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]