SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014879 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014879
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.63e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0013
Further Details:      
 
Domain Number 2 Region: 222-368
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-27
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 132-231
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014879   Gene: ENSGACG00000011236   Transcript: ENSGACT00000014907
Sequence length 377
Comment pep:known_by_projection group:BROADS1:groupXI:9631360:9640058:-1 gene:ENSGACG00000011236 transcript:ENSGACT00000014907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDQEDNGQRVKRLLGKPGNGNCADCGAADPEWASYTLGVFVCLSCSGLHRNIARISKV
KSVLLDPWSASEVELMDSVGNNAAKAKYEKIVPAFYYCPTHKDCMLLKEQWIRAKYERKE
FQCVERQEPYSAGYREGFLWKRGRDNGQYLSRKFILSEREGVLKYFKKHDAREPKATMKI
NTLNATFQPTKMGTAQGLQITYLKDNSTRNIFVYHEDGKEMVDWFNGIRAARFHYLQVAF
PGASISDLLPKLTRNYIMEGYMEKTGPKHTEGFKKRWFTMDERRLMYFKDPLDAYARGEV
FIGSRENSYSVHPGLPQNTQGYHWQFGITIVTPDRKFLFACETDEDQKDWISAFQTVINR
PMQPREYAVAAYFKHKP
Download sequence
Identical sequences G3PBA5
ENSGACP00000014879 69293.ENSGACP00000014879 ENSGACP00000014879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]