SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014897 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014897
Domain Number 1 Region: 1171-1393
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-61
Family DBL homology domain (DH-domain) 0.0000000509
Further Details:      
 
Domain Number 2 Region: 1393-1533
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-29
Family Pleckstrin-homology domain (PH domain) 0.00000183
Further Details:      
 
Domain Number 3 Region: 215-316
Classification Level Classification E-value
Superfamily EF-hand 3.11e-28
Family Eps15 homology domain (EH domain) 0.0023
Further Details:      
 
Domain Number 4 Region: 13-103
Classification Level Classification E-value
Superfamily EF-hand 1.04e-24
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 5 Region: 1545-1643
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-24
Family PLC-like (P variant) 0.0073
Further Details:      
 
Domain Number 6 Region: 1091-1175
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-22
Family SH3-domain 0.0000941
Further Details:      
 
Domain Number 7 Region: 958-1018
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-19
Family SH3-domain 0.00019
Further Details:      
 
Domain Number 8 Region: 706-797
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000125
Family SH3-domain 0.00031
Further Details:      
 
Domain Number 9 Region: 865-925
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000105
Family SH3-domain 0.00056
Further Details:      
 
Domain Number 10 Region: 1040-1105
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000223
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014897   Gene: ENSGACG00000011256   Transcript: ENSGACT00000014925
Sequence length 1675
Comment pep:known_by_projection group:BROADS1:groupXVIII:11449528:11468084:-1 gene:ENSGACG00000011256 transcript:ENSGACT00000014925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAYYRCCFSGGASVWAVTPEEREKYDKQFDALAPVLGYVSGEQARKFFLRSGLPASVLAE
IWNIADMDSDGKMDRQEFSIAMKLVKLKLQGRNLPSVLPIPMKQLPVAISAPNVPLSARF
GKGFTSNLKTLISEPFPWMGSMPNLSIGLSSMPCMSAMPILTPFPANPSMHAVQTFVPTP
MTLPLINCLGNSGLPNGNVNLRTPPLLPNSSGNSPKTGASDWAVPQGSRLKYRQQFNTLD
KLMSGYLSGPQVRNALIASNLTQTQLATIWNLADVDKDGQLRADEFILAMHLVDMAKTGR
PLPLTLPQDLVPPSLRGGIKPGELVNGTGPYIPPCLIDAPEIEPVLKTKSSVSFEDKLKE
NFARGSAELEKRRLARGNSPAREVPGTSGPPRPGDDRVPPCFQAAKLEMERQQREEWERG
MRQELGGRREGEQEEISRLRAKKKSLELELEDVGNKHKQISGRLRDAQSKRRILKAEVDH
VNQKRDSRNIEINTLQLQLEDWQKKLSLLVPEQHRLTEKLRNLNLNKISPVTLTSLSGSA
TEKGGNCRRLKGQLDTLERETTDKLAQMEQYNKELKSTGSFQNECMDSKVILFSFNALQK
KQKFGTVIIVQMNKQDAARRLKTRNASLLLHIVLHLLHQELREKQVRQQAVLDDLHRVKE
EKQRELQRRFTFHRQAKLEQERSLPPSSTGESQQERGGQPALEAQRPSELTAYRALYSFV
ARNADELSVDAGGLIECKGEYQVDEQAVGEPGWFCGSYRGNRGWFPQSYAEKCPTRSTAE
TAAPPSPGRLSRPPPPPLNSRSALPYVTVNNGLFLLFTRRIPDKKVACDIPSPAKPDASQ
RSISGESSHVYAGATDMCQESVATETETSVPLLARAVSSWSATSEKTLNLGSGDVIGVLQ
QRGDWWLGQLNGTQGWFPKSYVALETGGNTEYEDTQECTRLSELLSAHTQLTVCCSHSKY
VALYTYESPEVGDLTFVEGDVVMVTEREGEWWRGCIGDQTGVFPSNYVRPVEPEVQIVSK
PGAPIKKPEIAQAVTTAAVAPTTHQLHLSPGQLIVVLAKNSAGWWLGELQARGKKRQRGW
FHSSHVKLLGPSSSKSSPSPLPACDPEPSVCQVIAMYDYTAANRDELSFSKGQLISILDK
TNPDWWKGDANGATGLLPTNYVTMTTESDPSQQWCADLMTLDTMTPQERKRQGYIHELIR
TEETYVEDLELVLEVFYKPMSESGRLTEAETGAIFVNWRELIMCNTKLLKALRVRKKTEG
ENMPVQLIGDLLASELAHMQPYIRFCSCQLNAAALLQSKTHHQPDFKDFLRKIATNYRCK
GMPLSSFLLKPMQRITRYPLLIKNILEHTPDCHGDRGPLREALQRAEELCSQVNEGVREK
ENSDRLEWTQSHVQCEGAIEHLVFNSLTNCLGPRKLLHSGRLYKTKSSRELWAFLFNDFL
LLTHSAKPFSSSGPDKLFSLKTSIQLKMYKAPLFLNEVLVKRPPDPSSDEPIFHVSHIDR
VYALKTETLTERTTWVQKIKAASEQFIETEKKKREKAYQARSLKSSGIGRLLVTVSEALE
LKACKPNGKSNPYCELTMGAQCYTSRPISDTLNPKWNFHCQFFVKDLYQDILCVTVFEKD
QFSPDDFLGRTEVPVATIKKEMESKGAANRRLLLHEVPTGEVWVKLDLQLYESTK
Download sequence
Identical sequences G3PBC3
ENSGACP00000014897 69293.ENSGACP00000014897 ENSGACP00000014897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]