SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014906 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014906
Domain Number 1 Region: 26-281
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-91
Family Calponin-homology domain, CH-domain 0.000000946
Further Details:      
 
Domain Number 2 Region: 2182-2298
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-35
Family Pleckstrin-homology domain (PH domain) 0.00000353
Further Details:      
 
Domain Number 3 Region: 297-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-35
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 4 Region: 1647-1802
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-29
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 1012-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-29
Family Spectrin repeat 0.0000247
Further Details:      
 
Domain Number 6 Region: 594-734
Classification Level Classification E-value
Superfamily Spectrin repeat 3.34e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 7 Region: 1541-1697
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 1860-2014
Classification Level Classification E-value
Superfamily Spectrin repeat 6.22e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 9 Region: 819-953
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-27
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 1225-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-26
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 11 Region: 696-812
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-24
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 12 Region: 427-527
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 13 Region: 1386-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-17
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 14 Region: 498-598
Classification Level Classification E-value
Superfamily Spectrin repeat 7.67e-16
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 15 Region: 2019-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000518
Family Spectrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014906   Gene: ENSGACG00000011225   Transcript: ENSGACT00000014934
Sequence length 2351
Comment pep:known_by_projection group:BROADS1:groupVI:14477471:14520782:1 gene:ENSGACG00000011225 transcript:ENSGACT00000014934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMTSVAAEFEHMEIQQQYTTEGVNNRWDADDWDNENSSARLFERSRIKALADEREAVQKK
TFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDK
ALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDISVETEDNKEKKSAKDA
LLLWCQMKTAGYPNVNIHNFSTSWRDGMAFNAIIHKHRPDLIDFDKLKKSNAHHNLQNAF
NLAEQHLGLTKLLDAEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAI
ETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTE
KGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRTELIRQE
KLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERV
QAVVSVAKEMESENYHDIKRITARKDNVIRLWEYLLELLKARRQRLELTLGLQRVFQEML
YIMDWMDEMKMMLLSQDYGKHLLGVEDLLQKHALVEADISIQADRVRNVNRNAQKFADDM
DGYKPCDPQIIRDRVAHMDFCYQELSQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKE
QILSSEDYGKDLTGALRLLSQHKAFEDEMSGRAAHLQQTIKQGEELVANNHFGADKIKER
ILDIQEQWAALERLSAVRKARLQEACNQHQFQADADDIDTWMLDVLRIVSSVDVGHDEFS
TQALVKKHKDVAEEIGSYRPVIEALHEQSGTLPPEKAKSEEVQSRLAGIEERYKEVVELT
RLRKQALQDALALYKMLSEASACEVWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEM
NNQASRVAVVNQVARQLIHCGHPSEKEIKTQQDKLNTRWSQFRDLVDQKKDGLSSALGVQ
NYHLECNETKSWIKEKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEDKLGDLGKE
ADRLASEHPDQSEAIRGRLAGITAVWDEMKDTMKNREESLGEASKLQQFLRDLDDFQSWL
SRTQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGETVTQGQTDAQYM
FLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMP
TTLEAAEAAIKKQEDFMTTMDANEEKIGGVVDTGRRLVTDGNINAERAQEMVDSIDQRHK
KNRAAASDLLTRLKDNRDLQRFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQA
FMAELQSNKEWLDKIDKDGQALMAEKPETEAMVKEKLSSLKTMWQELESTTQAKAKCLFD
ANKAELFTQSCADLDKWLAGLDGQLQSDDYGKDLTSVNILLKKQQILESQVEVRQKEVGE
LQGQSQALSQEGKGSDEVDGQRISVEQKFQSLQDPLKKRRDNLMASREIHQFNRDVEDEI
LWVEERMPLATSTDHGNNLQTVQLAIKKNQTLQKEIQGHQPRYDDIFQRSQHVLRENGPT
AELIRQRLAELQSLWEQIRKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEE
KAKDEQSSVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAEHPDSERIGMRQSQVDKL
YAGLKDLSEERRGKLDERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQER
FREFARDTGNIGQERVDTVNQQADELINTGHGDAATIAEWKDGLNEAWADLLELIDTRTQ
ILAASFELHKFYHDAKEILHRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQ
VRQLQEDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLEAAEGRRVKLVETGDKFRFFSM
VRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKALLA
RKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQDPY
LFSREMGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRMQEEEEKRRQ
PPPTEAQPGDAAAQHREGELVSQNGLPSDQESTRISGYQQQCLDNVDGGEAVNGTSEPSP
SGSPGGSRKGKASQAATLPAKSQAEAPTSQLEGFLHRKHEWEGHNKKASSRSWHNVYCVI
NQQEMGFYKDQKSAGQGIPYHSEIPVTLKDAICEVALDYKKKKHVFKLKITDGNEYLFQA
KDDEEMNTWLSAISTAMTGEKSEVTPSSHSTPAPAARAQTLPASVAAAAESSPGKREKDK
EKRFSLFSKKK
Download sequence
Identical sequences G3PBD2
69293.ENSGACP00000014906 ENSGACP00000014906 ENSGACP00000014906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]